You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameTeriparatide
Accession NumberDB06285
TypeBiotech
GroupsApproved, Investigational
DescriptionTeriparatide (recombinant human parathyroid hormone) is a potent anabolic agent used in the treatment of osteoporosis. It is manufactured and marketed by Eli Lilly and Company.
Protein structureNo structure small
Related Articles
Protein chemical formulaC181H291N55O51S2
Protein average weight4117.715 Da
Sequences
>Parathyroid hormone precursor - Homo sapiens (1-34)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Download FASTA Format
Synonyms
Teriparatide recombinant human
External IDs Not Available
Product Ingredients
IngredientUNIICASInChI KeyDetails
Teriparatide acetate9959P4V12N 99294-94-7Not applicableDetails
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ForteoSolution250 mcgSubcutaneousEli Lilly & Co. Ltd.2004-07-15Not applicableCanada
ForteoInjection, solution250 ug/mLSubcutaneousEli Lilly & Co. Ltd.2002-11-26Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
ForsteoEli Lilly and Company
Brand mixturesNot Available
Categories
UNII10T9CSU89I
CAS number52232-67-4
Pharmacology
IndicationFor the treatment of osteoporosis in men and postmenopausal women who are at high risk for having a fracture. Also used to increase bone mass in men with primary or hypogonadal osteoporosis who are at high risk for fracture.
Structured Indications
PharmacodynamicsClinical trials indicate that teriparatide increases predominantly trabecular bone in the lumbar spine and femoral neck; it has less significant effects at cortical sites. The combination of teriparatide with antiresorptive agents is not more effective than teriparatide monotherapy. The most common adverse effects associated with teriparatide include injection-site pain, nausea, headaches, leg cramps, and dizziness. After a maximum of two years of teriparatide therapy, the drug should be discontinued and antiresorptive therapy begun to maintain bone mineral density.
Mechanism of actionTeriparatide is the portion of human parathyroid hormone (PTH),amino acid sequence 1 through 34 of the complete molecule which contains amino acid sequence 1 to 84. Endogenous PTH is the primary regulator of calcium and phosphate metabolism in bone and kidney. Daily injections of teriparatide stimulate new bone formation leading to increased bone mineral density.
TargetKindPharmacological actionActionsOrganismUniProt ID
Parathyroid hormone/parathyroid hormone-related peptide receptorProteinunknown
binder
HumanQ03431 details
Related Articles
AbsorptionBioavailability is 95% following subcutaneous injection.
Volume of distribution
  • 0.12 L/kg
Protein bindingNot Available
Metabolism

Hepatic

Route of eliminationPeripheral metabolism of PTH is believed to occur by non-specific enzymatic mechanisms in the liver followed by excretion via the kidneys. The 24-hour urine excretion of calcium was reduced by a clinically unimportant amount (15%).
Half lifeNot Available
Clearance
  • 62 L/hr [Women]
  • 94 L/hr [Men]
ToxicityEffects of overexposure may include headaches, dizziness, dizziness, decreased blood pressured, decreased fetal survival, leg cramps, changes in clinical chemistry including increased in blood levels of calcium, decreased serum phosphorous, and increased urinary calcium and phosphorus.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions Not Available
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Stroup J, Kane MP, Abu-Baker AM: Teriparatide in the treatment of osteoporosis. Am J Health Syst Pharm. 2008 Mar 15;65(6):532-9. doi: 10.2146/ajhp070171. [PubMed:18319498 ]
  2. Close P, Neuprez A, Reginster JY: Developments in the pharmacotherapeutic management of osteoporosis. Expert Opin Pharmacother. 2006 Aug;7(12):1603-15. [PubMed:16872263 ]
External Links
ATC CodesH05AA02
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelNot Available
MSDSDownload (24.4 KB)
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedNot AvailableHealthy Volunteers1
1CompletedTreatmentBone Loss / Periodontitis1
1CompletedTreatmentDrug Safety1
1CompletedTreatmentOsteoporosis1
1CompletedTreatmentOsteoporosis, Post-Menopausal1
1CompletedTreatmentPostmenopausal Osteoporosis (PMO)1
1Enrolling by InvitationTreatmentDrug Safety and Bioavailability1
1Unknown StatusBasic ScienceOsteoporosis1
2Active Not RecruitingTreatmentAdult Idiopathic Generalized Osteoporosis1
2Active Not RecruitingTreatmentAnorexia Nervosa (AN) / Osteoporosis1
2Active Not RecruitingTreatmentBone Loss / Osteoporosis / Spinal Cord Injuries (SCI)2
2Active Not RecruitingTreatmentDiabetic Neuropathic Arthropathy1
2Active Not RecruitingTreatmentOsteoporosis2
2CompletedPreventionOsteoarthritis of the Knees1
2CompletedTreatmentColles' Fracture1
2CompletedTreatmentOsteoporosis8
2CompletedTreatmentPostmenopausal Osteoporosis (PMO)1
2CompletedTreatmentParathyroid deficiency1
2Not Yet RecruitingTreatmentCartilage Degeneration / Osteoarthritis,Knee1
2Not Yet RecruitingTreatmentOsteoporotic Fracture1
2RecruitingTreatmentAutosomal Dominant Hypocalcemia1
2RecruitingTreatmentOsteogenesis Imperfecta1
2TerminatedPreventionAplastic Anaemia (AA) / Hodgkins Disease (HD) / Leukemia, Lymphocytic, Acute / Leukemia, Lymphocytic, Chronic / Leukemia, Myelocytic, Acute / Leukemia,Myeloid, Chronic / Lymphoma NOS / Myelofibrosis1
2TerminatedTreatmentHypocalcemia1
2TerminatedTreatmentHypoparathyroidism Post-surgical1
2TerminatedTreatmentImplants1
2TerminatedTreatmentOsteoporosis1
2Unknown StatusTreatmentOsteopenia / Osteoporosis1
2WithdrawnTreatmentOsteopenia / Osteoporosis1
2WithdrawnTreatmentShoulder Fractures / Trochanteric Fractures1
2, 3Active Not RecruitingTreatmentFractures / Menopause / Osteoporosis1
2, 3CompletedTreatmentParathyroid deficiency1
3CompletedTreatmentBack Pain / Postmenopausal Osteoporosis (PMO) / Spinal Fractures1
3CompletedTreatmentFemur Neck Fracture2
3CompletedTreatmentOsteopenia / Osteoporosis1
3CompletedTreatmentOsteoporosis10
3CompletedTreatmentOsteoporosis, Post-Menopausal3
3CompletedTreatmentOsteoporosis / Postmenopausal Osteoporosis (PMO)1
3CompletedTreatmentPostmenopausal Osteoporosis (PMO)4
3RecruitingTreatmentNon Displaced Atypical Femoral Fractures1
3RecruitingTreatmentOsteoporosis1
3Unknown StatusTreatmentLow Bone Mass in Anorexia Nervosa Patients1
3WithdrawnTreatmentHumeral Fractures / Osteoporosis, Age-Related1
4Active Not RecruitingTreatmentPostmenopausal Osteoporosis (PMO)1
4Active Not RecruitingTreatmentRheumatoid Arthritis1
4CompletedTreatmentAtypical Femoral Fractures / Osteoporosis1
4CompletedTreatmentBone Loss / Osteoporosis / Spinal Cord Injuries (SCI)1
4CompletedTreatmentHumeral Fractures1
4CompletedTreatmentOsteogenesis Imperfecta1
4CompletedTreatmentOsteoporosis10
4CompletedTreatmentOsteoporosis, Post-Menopausal2
4CompletedTreatmentPostmenopausal Osteoporosis (PMO)7
4RecruitingTreatmentFracture, Ankle1
4SuspendedTreatmentBone Marrow Oedema Syndrome / High Turnover Bone Disease / Quality of Life1
4TerminatedTreatmentOsteoporosis1
4Unknown StatusTreatmentFractures1
4Unknown StatusTreatmentPostmenopausal Osteoporosis With Pathological Fracture1
4Unknown StatusTreatmentSpinal Stenosis1
Not AvailableActive Not RecruitingNot AvailableLow Bone Density1
Not AvailableActive Not RecruitingNot AvailableOsteoporosis1
Not AvailableActive Not RecruitingNot AvailableOsteoporosis, Steroid Induced / Postmenopausal Osteoporosis (PMO)1
Not AvailableCompletedNot AvailableOsteoporosis4
Not AvailableCompletedNot AvailableOsteoporosis / Postmenopausal Osteoporosis (PMO)1
Not AvailableCompletedDiagnosticHyperparathyroidism, Secondary1
Not AvailableRecruitingNot AvailableOsteoporosis1
Not AvailableRecruitingTreatmentAdult Degenerative Lumbar Scoliosis / Lumbar Spondylolisthesis / Lumbar Spondylosis1
Not AvailableRecruitingTreatmentKidney Failure,Chronic1
Not AvailableRecruitingTreatmentOsteoporosis1
Not AvailableTerminatedTreatmentPelvic Fractures1
Not AvailableUnknown StatusTreatmentOsteoporosis1
Not AvailableWithdrawnTreatmentOsteoporosis1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous250 ug/mL
SolutionSubcutaneous250 mcg
Prices
Unit descriptionCostUnit
Forteo 750 mcg/3 ml pen295.26USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2314313 No2005-02-082018-12-08Canada
CA2325371 No2004-08-172019-08-19Canada
US6770623 No1998-12-082018-12-08Us
US6977077 No1999-08-192019-08-19Us
US7144861 No1998-12-082018-12-08Us
US7163684 No1999-08-192019-08-19Us
US7351414 No1999-08-192019-08-19Us
US7517334 No2005-03-252025-03-25Us
US7550434 No1998-12-082018-12-08Us
Properties
StateLiquid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
binder
General Function:
Protein self-association
Specific Function:
This is a receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
Gene Name:
PTH1R
Uniprot ID:
Q03431
Molecular Weight:
66359.98 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Comments
comments powered by Disqus
Drug created on March 19, 2008 10:21 / Updated on April 24, 2017 04:37