Motavizumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Name
Motavizumab
Accession Number
DB06310
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description
Not Available
Protein structure
Db06310
Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>8693_H|motavizumab|Humanized||H-GAMMA-1 (VH(1-120)+CH1(121-218)+HINGE-REGION(219-233)+CH2(234-343)+CH3(344-450))|||||||450||||MW 49607.2|MW 49607.2|
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKH
YNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8693_L|motavizumab|Humanized||L-KAPPA (V-KAPPA(1-106)+C-KAPPA(107-213))|||||||213||||MW 23127.7|MW 23127.7|
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKH
YNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • anti-RSV Mab
External IDs
MEDI-524
International/Other Brands
Numax
Categories
UNII
50Y163LK8Q
CAS number
677010-34-3

Pharmacology

Indication

Investigated for use/treatment in viral infection and pediatric indications.

Pharmacodynamics
Not Available
Mechanism of action

Motavizumab is a second generation, ultra-potent, affinity-matured, humanized mAb derived from palivizumab that reduces replication of Respiratory Syncytial Virus (RSV), a pathogen which causes lower respiratory tract disease.

Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Motavizumab.
AbituzumabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Abituzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Motavizumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Motavizumab.
AducanumabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Motavizumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Motavizumab.
AlirocumabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Amatuximab.
AMG 108The risk or severity of adverse effects can be increased when AMG 108 is combined with Motavizumab.
Food Interactions
Not Available

References

General References
  1. Wu H, Pfarr DS, Johnson S, Brewah YA, Woods RM, Patel NK, White WI, Young JF, Kiener PA: Development of motavizumab, an ultra-potent antibody for the prevention of respiratory syncytial virus infection in the upper and lower respiratory tract. J Mol Biol. 2007 May 4;368(3):652-65. Epub 2007 Feb 20. [PubMed:17362988]
External Links
Wikipedia
Motavizumab
ATC Codes
J06BB17 — Motavizumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedPreventionInfections, Respiratory Syncytial Virus1
1CompletedTreatmentHealthy Volunteers1
1CompletedTreatmentInfections, Respiratory Syncytial Virus1
1, 2CompletedPreventionMotavizumab Administration for a Second Season for RSV Prophylaxis1
1, 2CompletedTreatmentInfections, Respiratory Syncytial Virus1
2CompletedPreventionChronic Lung Disease and <= 24 Months of Age or / Infections, Respiratory Syncytial Virus / Premature With Gestational Age <=35 Weeks and <=6 Months of Age1
2CompletedPreventionCongenital Heart Disease (CHD)1
2CompletedTreatmentHealthy Volunteers1
2CompletedTreatmentRespiratory Syncytial Virus (RSV)1
3CompletedPreventionInfections, Respiratory Syncytial Virus1
3CompletedTreatmentHealthy Volunteers1
3WithdrawnTreatmentWheezing1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Drug created on March 19, 2008 10:23 / Updated on November 02, 2018 06:15