Atacicept

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Name
Atacicept
Accession Number
DB06399
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Fusion proteins
Description

Atacicept is a recombinant fusion protein combined with the extracellular ligand binding portion of TACI.

Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>8669_F|atacicept|Homo sapiens||FUSION-TNFRSF13B-GAMMA-1 (TNFRSF13B(Pr30-110)(1-81)+HINGE-REGION(82-96)+CH2(97-206)+CH3(207-313))|||||||313||||MW 35372.1|MW 35372.1|
AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISC
ASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMIS
RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL
NGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP
SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN
HYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • TACI-Ig
Categories
UNII
K3D9A0ICQ3
CAS number
845264-92-8

Pharmacology

Indication

Investigated for use/treatment in autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid).

Pharmacodynamics
Not Available
Mechanism of action

Atacicept contains the soluble TACI receptor that binds to the cytokines BLyS and APRIL. These cytokines are members of the tumor necrosis factor family that promote B-cell survival and autoantibody production associated with certain autoimmune diseases such as systemic lupus erythematosus. Current data indicates that levels of BLyS and APRIL are elevated in patients with rheumatoid arthritis, lupus erythematosus, B-cell malignancies and multiple sclerosis. Atacicept has been shown to affect several stages of B-cell development and may inhibit the survival of cells responsible for making antibodies.

Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
Not Available
Food Interactions
Not Available

References

General References
Not Available
External Links
Wikipedia
Atacicept

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1TerminatedTreatmentNephritis, Lupus1
2CompletedTreatmentLupus Erythematosus, Systemic2
2CompletedTreatmentRheumatoid Arthritis3
2RecruitingTreatmentIgA Nephropathy1
2TerminatedTreatmentOptic Neuritis1
2TerminatedTreatmentRelapsing Multiple Sclerosis (RMS)2
2WithdrawnTreatmentSystemic Lupus Erythematosus (SLE)1
2, 3CompletedTreatmentLupus Erythematosus, Systemic1
2, 3TerminatedTreatmentNephritis, Lupus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Drug created on March 19, 2008 10:28 / Updated on November 02, 2018 06:16