Teplizumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates
Name
Teplizumab
Accession Number
DB06606
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description
Not Available
Protein structure
Db06606
Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>8869_H|teplizumab|Humanized||H-GAMMA-1 (VH(1-119)+CH1(120-217)+HINGE-REGION(218-232)+CH2(233-342)+CH3(343-449))|||||||449||||MW 49611.9|MW 49611.9|
QVQLVQSGGGVVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNY
NQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDDHYCLDYWGQGTPVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8869_L|teplizumab|Humanized||L-KAPPA (V-KAPPA(1-105)+C-KAPPA(107-213))|||||||213||||MW 23304.7|MW 23304.7|
DIQMTQSPSSLSASVGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSR
FSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQITRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
External IDs
MGA-031 / MGA031
Categories
UNII
S4M959U2IJ
CAS number
876387-05-2

Pharmacology

Indication

Investigated for use/treatment in diabetes mellitus type 1.

Pharmacodynamics
Not Available
Mechanism of action
Not Available
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Teplizumab.
AbituzumabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Abrilumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Teplizumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Teplizumab.
AducanumabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Teplizumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Teplizumab.
AlirocumabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Amatuximab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
Not Available
External Links
Wikipedia
Teplizumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1, 2RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
1, 2TerminatedTreatmentPsoriasis1
2Active Not RecruitingTreatmentAutoantibody Positive / High Risk / Impaired Glucose Tolerance / Non-diabetic Relatives at Risk for Type 1 Diabetes1
2CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus2
2TerminatedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2, 3CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2, 3TerminatedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
3CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
3RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Drug created on March 19, 2008 10:40 / Updated on December 02, 2019 07:25