Identification

Name
Ofatumumab
Accession Number
DB06650
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Ofatumumab is a novel anti-CD20 monoclonal antibody that targets B-cells. It is an IgG1κ human monoclonal antibody produced from a recombinant murine cell line (NS0) via transgenic mouse and hybridoma technology.6 Ofatumumab works by recognizing antigens that are expressed on the tumour cells in certain cancers; however, the antigen is not tumour-specific and can also be found in normal B-cells.1 Ofatumumab was first approved by the FDA in 2009.8 It is used in the treatment of recurrent, progressive, or recurrent chronic lymphocytic leukemia (CLL) or CLL in treatment-naive patients in whom fludarabine-based therapy is considered inappropriate. Ofatumumab is used as monotherapy or in combination with other medications, depending on the patient profile and previous treatment history.6 Although it has a similar molecular mechanism of action as rituximab, another CD-20 monoclonal antibody used in the treatment of rheumatoid arthritis and B-cell non-Hodgkin's lymphoma, ofatumumab has a higher affinity towards CD20.1

Ofatumumab is available for intravenous administration and is marketed as Arzerra. In Phase III clinical trials consisting of subjects with relapsing forms of multiple sclerosis (RMS), subcutaneous administration of ofatumumab reduced the number of relapses and delayed disease progression. In February 2020, FDA and EMA approved Supplemental Biologics License Application (sBLA) and Marketing Authorization Application (MAA), respectively, for ofatumumab for the treatment of RMS in adults. The approval for the use of ofatumumab in RMS is expected to occur in 2020 and 2021.7 The potential therapeutic use of ofatumumab in various lymphomas and rheumatoid arthritis has also been investigated.4

Protein structure
Db06650
Protein chemical formula
C6480H10022N1742O2020S44
Protein average weight
146100.0 Da
Sequences
>Ofatumumab Heavy Chain
EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSTISWNSGSIGY
ADSVKGRFTISRDNAKKSLYLQMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTV
SSASTKGPSVFPLAPGSSKSTSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
>Ofatumumab Light Chain
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPITFGQGTRLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Download FASTA Format
Synonyms
  • HuMax-CD20
  • HuMax-CD20, 2F2
  • Ofatumumab
  • Ofatumumabum
External IDs
GSK 1841157 / GSK-1841157 / GSK1841157 / GSKI841157 / HSDB 8170
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ArzerraSolution1000 mgIntravenousNovartis2012-08-132019-03-01Canada
ArzerraSolution100 mgIntravenousNovartis2012-08-132019-03-01Canada
ArzerraInjection, solution20 mg/1mLIntravenousNovartis Pharmaceuticals Corporation2016-02-01Not applicableUs
ArzerraInjection, solution20 mg/1mLIntravenousNovartis Pharmaceuticals Corporation2016-02-01Not applicableUs
ArzerraInjection, solution20 mg/1mLIntravenousGlaxosmithkline Inc2011-07-222017-08-31Us
ArzerraInjection20 mg/1mLIntravenousGlaxosmithkline Inc2009-10-262012-03-31Us
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Categories
UNII
M95KG522R0
CAS number
679818-59-8

Pharmacology

Indication

Ofatumumab is indicated, in combination with chlorambucil, for the treatment of previously untreated patients with chronic lymphocytic leukemia (CLL) for whom fludarabine-based therapy is considered inappropriate.6

In patients with recurrent or progressive CLL, ofatumumab is indicated for extended treatment of patients who are in complete or partial response after at least two lines of therapy for recurrent or progressive CLL.6

Ofatumumab is indicated for the treatment of patients with CLL refractory to fludarabine and alemtuzumab.6

Associated Conditions
Pharmacodynamics

Ofatumumab works by binding to and blocking the action of CD-20, a molecule expressed on the surface of both healthy and leukemic B lymphocytes. In patients with previously untreated chronic lymphocytic leukemia (CLL), ofatumumab caused B-cell depletion in the peripheral blood after six months following the last dose. However, observable depletion of B cells in the peripheral blood does not directly correlate with the depletion of B-cells in solid organs or malignant tumours.6 In vitro, ofatumumab induces complement-dependent cytotoxicity (CDC) and antibody-dependent cellular cytotoxicity (ADCC).1

Mechanism of action

CD20 is expressed on normal pre-B lymphocytes and mature B lymphocytes, as well as malignant B lymphocytes. Numerous studies demonstrate that the depletion of B-cells can significantly alleviate symptoms of many forms of leukemia and lymphoma, which are malignancies associated with B-cell dysfunctions and high expression of CD20.4

Ofatumumab is an anti-CD20 monoclonal antibody that binds to the small and large extracellular loops of the CD20 molecule. The Fab domain of ofatumumab binds to CD20, and this drug-target interaction does not result in immediate shedding and internalization of CD20 from the plasma membrane of B lymphocytes.2,6 This allows ofatumumab to persist on the B lymphocyte cell surface for an extended period and recruit immunological molecules or FcR-expressing innate effectors, such as macrophages, that mediate immune effector functions with strong cytotoxic effects.2,4 These immune effector functions include complement-dependent cytotoxicity (CCD) and antibody-dependent cellular cytotoxicity (ADCC), which promote the lysis of malignant B-cells.2,4,6 Complement-dependent cytotoxicity (CDC) involves translocation of the CD20 molecule into lipid rafts, which are involved in cell signalling and receptor trafficking.1

TargetActionsOrganism
AB-lymphocyte antigen CD20
antibody
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

In one study consisting of patients with relapsed or refractory chronic lymphocytic leukemia and small lymphocytic lymphoma, the Cmax was 94 μg/mL and the Tmax was 7.3 hours following the first infusion of 300 mg ofatumumab.5

Volume of distribution

In patients with CLL, the mean volume of distribution at steady state was 5.8 L.6

Protein binding

There is limited information on the serum protein binding profile of ofatumumab.

Metabolism

Like other monoclonal antibodies, ofatumumab is expected to undergo lysosomal degradation by the reticuloendothelial system and protein catabolism by a target‐mediated disposition pathway.3

Route of elimination

Ofatumumab undergoes elimination by a target-independent route and a target (B cell)-mediated route, with a dose-dependent clearance in the dose range of 100 to 2000 mg. As ofatumumab causes B-cell depletion, the clearance of ofatumumab mediated by B-cells is decreased substantially after subsequent drug infusions.6

Half life

In patients with CLL, the mean half-life at steady state was 17.1 days.6

Clearance

In patients with CLL, the mean clearance at steady state was 11.6 mL/hour.6

Toxicity

There is limited information on overdose of ofatumumab. Ofatumumab may cause B-cell depletion in the fetus when administered in pregnant women.6

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ofatumumab.
AbituzumabThe risk or severity of adverse effects can be increased when Ofatumumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Ofatumumab is combined with Abrilumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Ofatumumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Ofatumumab.
AducanumabThe risk or severity of adverse effects can be increased when Ofatumumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Ofatumumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Ofatumumab.
AlirocumabThe risk or severity of adverse effects can be increased when Ofatumumab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Ofatumumab is combined with Amatuximab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
No interactions found.

References

General References
  1. Lin TS: Ofatumumab: a novel monoclonal anti-CD20 antibody. Pharmgenomics Pers Med. 2010;3:51-9. Epub 2010 May 10. [PubMed:23226042]
  2. Glennie MJ, French RR, Cragg MS, Taylor RP: Mechanisms of killing by anti-CD20 monoclonal antibodies. Mol Immunol. 2007 Sep;44(16):3823-37. [PubMed:17768100]
  3. Ryman JT, Meibohm B: Pharmacokinetics of Monoclonal Antibodies. CPT Pharmacometrics Syst Pharmacol. 2017 Sep;6(9):576-588. doi: 10.1002/psp4.12224. Epub 2017 Jul 29. [PubMed:28653357]
  4. Zhang B: Ofatumumab. MAbs. 2009 Jul-Aug;1(4):326-31. doi: 10.4161/mabs.1.4.8895. Epub 2009 Jul 1. [PubMed:20068404]
  5. Ogura M, Hatake K, Tobinai K, Uchida T, Suzuki T, Terui Y, Yokoyama M, Maruyama D, Mori M, Jewell RC, Katsura K, Hotta T: Phase I study of ofatumumab, a human anti-CD20 antibody, in Japanese patients with relapsed or refractory chronic lymphocytic leukemia and small lymphocytic lymphoma. Jpn J Clin Oncol. 2013 May;43(5):466-75. doi: 10.1093/jjco/hyt022. Epub 2013 Feb 28. [PubMed:23456745]
  6. FDA Approved Drug Products: ARZERRA (ofatumumab) injection, for intravenous use [Link]
  7. Novartis announces FDA and EMA filing acceptance of ofatumumab, a novel B-cell therapy for patients with relapsing forms of multiple sclerosis (RMS) [Link]
  8. Arzerra (ofatumumab) FDA Approval History - Drugs.com [Link]
External Links
KEGG Drug
D09314
PubChem Substance
347910355
RxNav
712566
ChEMBL
CHEMBL1201836
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Ofatumumab
ATC Codes
L01XC10 — Ofatumumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (153 KB)
MSDS
Download (92 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedOtherChronic Lymphocytic Leukaemia (CLL)1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Follicular Lymphoma (FL) / Leukaemia, Lymphocytic, Chronic and Lymphoma, Follicular1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Indolent Non-Hodgkin's Lymphomas / Mantle Cell Lymphoma (MCL)1
1CompletedTreatmentMalignancies1
1CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentRheumatoid Arthritis1
1TerminatedTreatmentB-Cell Non-Hodgkin Lymphomas(NHL) / Chronic Lymphocytic Leukaemia (CLL)1
1TerminatedTreatmentChronic Lymphocytic Leukemia (CLL) - Refractory / Chronic, recurrent Lymphocytic Leukemia / Recurrent Small Lymphocytic Lymphoma / Refractory Small Lymphocytic Lymphoma1
1, 2Active Not RecruitingTreatmentChronic Graft Versus Host Disease1
1, 2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
1, 2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia / Prolymphocyctic Leukemia / Richter's Transformation / Small Lymphocytic Lymphoma1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Chronic Lymphocytic Leukemia (CLL) - Refractory / Leukemia, Prolymphocytic / Recurrent Small Lymphocytic Lymphoma1
1, 2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
1, 2Unknown StatusTreatmentMantle Cell Lymphoma (MCL)1
1, 2WithdrawnTreatmentChronic Lymphocytic Leukaemia (CLL)1
1, 2WithdrawnTreatmentFollicular Lymphoma (FL)1
2Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult Acute Lymphoblastic Leukemia in Complete Remission / Burkitt's Lymphoma / CD20 Positive / Childhood Acute Lymphoblastic Leukemia in Complete Remission / Leukemias / Lymphoma, Lymphoblastic1
2Active Not RecruitingTreatmentAcute Lymphoblastic Leukemia in Remission / Acute Lymphocytic Leukemia (ALL) / B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia, Philadelphia Chromosome Negative1
2Active Not RecruitingTreatmentAnn Arbor Stage III Grade 1 Follicular Lymphoma / Ann Arbor Stage III Grade 2 Follicular Lymphoma / Ann Arbor Stage III Grade 3 Follicular Lymphoma / Ann Arbor Stage IV Grade 1 Follicular Lymphoma / Ann Arbor Stage IV Grade 2 Follicular Lymphoma / Ann Arbor Stage IV Grade 3 Follicular Lymphoma / Grade 3a Follicular Lymphoma1
2Active Not RecruitingTreatmentB-cell Lymphoid Leukemia / Young Patients1
2Active Not RecruitingTreatmentCLL (Chronic Lymphocytic Leukemia) / Small Lymphocytic Lymphoma1
2Active Not RecruitingTreatmentChronic Lymphocytic Leucemia / Chronic Lymphocytic Leukaemia (CLL)1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)4
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma3
2Active Not RecruitingTreatmentDiffuse Large Cell Lymphoma Relapsed/Refractory1
2Active Not RecruitingTreatmentDisseminated Sclerosis1
2Active Not RecruitingTreatmentFollicular Lymphoma Grade 3A / Follicular Lymphoma, Grade 1 / Follicular Lymphoma, Grade 21
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas1
2Active Not RecruitingTreatmentLymphoma, B-Cell1
2Active Not RecruitingTreatmentMalignant Lymphomas1
2Active Not RecruitingTreatmentMantle Cell Lymphoma (MCL)1
2Active Not RecruitingTreatmentRelapsing Multiple Sclerosis (RMS)1
2Active Not RecruitingTreatmentStage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
2Active Not RecruitingTreatmentStage I Mantle Cell Lymphoma / Stage II Contiguous Mantle Cell Lymphoma / Stage II Non-Contiguous Mantle Cell Lymphoma / Stage III Mantle Cell Lymphoma / Stage IV Mantle Cell Lymphoma1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia / Chronic Lymphocytic Leukaemia (CLL) / Contiguous Stage II Small Lymphocytic Lymphoma / Hematopoietic/Lymphoid Cancer / Noncontiguous Stage II Small Lymphocytic Lymphoma / Stage 0 Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage I Small Lymphocytic Lymphoma / Stage II Chronic Lymphocytic Leukemia / Stage II Small Lymphocytic Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Small Lymphocytic Lymphoma1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)11
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Fatigue / Fevers / Hypogammaglobulinemia / Lymphadenopathy / Lymphocytosis / Night Sweats / Paraproteinemia / Small Lymphocytic Lymphoma / Thrombocytopenia1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma1
2CompletedTreatmentDisseminated Sclerosis2
2CompletedTreatmentFollicular Lymphoma (FL)2
2CompletedTreatmentFollicular Lymphoma (FL) / Marginal Zone Lymphoma (MZL) / Small Lymphocytic Lymphoma1
2CompletedTreatmentHodgkins Disease (HD)1
2CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)2
2CompletedTreatmentLymphoma, Large-Cell, Diffuse2
2CompletedTreatmentMalignant Lymphomas1
2CompletedTreatmentNon Previously Treated CD20+ Diffuse Large B-cell Lymphoma1
2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)2
2CompletedTreatmentPatients With CLL Refractory (SD, PD or CR/PR < 6 Months) Following no More Than Two Prior Treatment Lines / Patients With CLL Relapsing After an Initial Response (CR, PR ≥ 6 Months) Following no More Than Two Prior Treatment Lines; or1
2CompletedTreatmentRelapsed NLPHL1
2CompletedTreatmentRichter's Syndrome1
2CompletedTreatmentStage III Melanoma / Stage IV Melanoma1
2CompletedTreatmentWaldenström's Macroglobulinemia (WM)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemia Recurrent / AIDS-Related Burkitt Lymphoma / Atypical Burkitt/Burkitt-Like Lymphoma / High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements / High Grade B-Cell Lymphoma With MYC, BCL2, and BCL6 Rearrangements / High-Grade B-Cell Lymphoma With MYC, BCL2, and BCL6 Rearrangements / Leukemias / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Burkitt Lymphoma / Refractory Acute Lymphoblastic Leukemia / Refractory Adult Acute Lymphoblastic Leukemia / Refractory Burkitt Lymphoma / Refractory Childhood Acute Lymphoblastic Leukemia1
2RecruitingTreatmentAcute Lymphoblastic Leukaemia Recurrent / Acute Lymphoblastic Leukaemias (ALL) / Burkitt Leukemia/Lymphoma / Burkitt's Lymphoma / Hematopoietic/Lymphoid Cancer / High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements / Lymphoblastic lymphoma (Precursor T-lymphoblastic lymphoma/leukemia) refractory / Lymphoma, Lymphoblastic / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Burkitt Leukemia / Recurrent Burkitt Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements / Refractory Acute Lymphoblastic Leukemia / Refractory Burkitt Leukemia / Refractory Burkitt Lymphoma / Refractory High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / B Acute Lymphoblastic Leukemia / B Lymphoblastic Lymphoma / Leukemias1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)2
2RecruitingTreatmentLeukemia, Lymphoblastic, Chronic1
2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
2RecruitingTreatmentNephrotic Syndrome2
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL)1
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma2
2TerminatedTreatmentLeukemias / Lymphoma, Lymphoblastic / Malignant Lymphomas / Precursor-B Acute Lymphoblastic Leukemia1
2TerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)2
2TerminatedTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
2TerminatedTreatmentRheumatoid Arthritis1
2TerminatedTreatmentWaldenström's Macroglobulinemia (WM)1
2WithdrawnTreatmentChronic Lymphocytic Leukaemia (CLL)1
2WithdrawnTreatmentFollicular Lymphoma (FL) / Lymphoma, B-Cell, Marginal Zone / Lymphoma, Intermediate-Grade / Lymphoma, Low-Grade / Non-Hodgkin's Lymphoma (NHL)1
3Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma1
3Active Not RecruitingTreatmentRelapsing Multiple Scelrosis1
3Active Not RecruitingTreatmentRelapsing Multiple Sclerosis (RMS)1
3CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)2
3CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
3CompletedTreatmentLymphoma, Large-Cell, Diffuse1
3CompletedTreatmentRelapsed or Refractory Chronic Lymphocytic Leukemia (CLL) / Small Lymphocytic Lymphoma1
3Enrolling by InvitationTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma1
3RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
3RecruitingTreatmentRelapsing Multiple Sclerosis (RMS)1
3TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL)3
3TerminatedTreatmentFollicular Lymphoma (FL)1
3TerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)1
3TerminatedTreatmentPemphigus1
3TerminatedTreatmentPemphigus / Pemphigus Vulgaris (PV)1
3TerminatedTreatmentRheumatoid Arthritis2
4CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)1
Not AvailableCompletedNot AvailableChronic Lymphocytic Leukaemia (CLL)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
InjectionIntravenous20 mg/1mL
Injection, solutionIntravenous20 mg/1mL
SolutionIntravenous100 mg
SolutionIntravenous1000 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US8337847No2012-12-252028-11-25Us
US8975282No2015-03-102032-07-28Us
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Mhc class ii protein complex binding
Specific Function
This protein may be involved in the regulation of B-cell activation and proliferation.
Gene Name
MS4A1
Uniprot ID
P11836
Uniprot Name
B-lymphocyte antigen CD20
Molecular Weight
33076.99 Da
References
  1. Dorner T, Burmester GR: New approaches of B-cell-directed therapy: beyond rituximab. Curr Opin Rheumatol. 2008 May;20(3):263-8. doi: 10.1097/BOR.0b013e3282f5e08d. [PubMed:18388516]
  2. Glennie MJ, French RR, Cragg MS, Taylor RP: Mechanisms of killing by anti-CD20 monoclonal antibodies. Mol Immunol. 2007 Sep;44(16):3823-37. [PubMed:17768100]
  3. Du J, Yang H, Guo Y, Ding J: Structure of the Fab fragment of therapeutic antibody Ofatumumab provides insights into the recognition mechanism with CD20. Mol Immunol. 2009 Jul;46(11-12):2419-23. doi: 10.1016/j.molimm.2009.04.009. Epub 2009 May 8. [PubMed:19427037]

Drug created on March 19, 2008 10:44 / Updated on April 10, 2020 01:40

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates