Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens.

HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females.

Protein structure

Protein chemical formula

Not Available

Protein average weight

Not Available

Sequences

>Alpha Chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

>Beta Chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ

Download FASTA Format

Synonyms

Chorionic gonadotrophin
Chorionic gonadotropin
Gonadotropin, Chorionic
Gonadotropin,chorionic
h-HCG
hCG
Human chorionic gonadotropin
Human menopausal gonadotropin
Human menopausal gonadotropin (urine derived)
Human-chorionic gonadotropin
Urinary hCG

Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Unlock Additional Data
Apl Inj 1000 Iu/ml	Liquid		Intramuscular	Ayerst Laboratories	1951-12-31	2000-08-02
Chorionic Gonadotropin for Injection, USP	Powder, for solution		Intramuscular; Subcutaneous	Fresenius Kabi	2004-09-13	Not applicable
Novarel		5000 [USP'U]/1	Intramuscular	Ferring Pharmaceuticals Inc.	1974-01-15	Not applicable
Novarel		10000 [USP'U]/1	Intramuscular	Ferring Pharmaceuticals Inc.	1974-01-15	Not applicable
Profasi Hp Inj 10000unit/vial USP	Powder, for solution		Intramuscular	Pharmascience Inc	1984-12-31	2009-04-29

Additional Data Available

Application Number

A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

Learn more

Product Code

A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

Learn more

Mixture Products

Name	Ingredients	Dosage	Route	Labeller	Marketing Start	Marketing End
A.P.L. - Pws-liq	Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)	Liquid; Powder, for solution	Intramuscular	Wyeth Ayerst Canada Inc.	1998-11-11	2001-06-01
Pregnyl	Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)	Kit; Liquid; Powder, for solution	Intramuscular	Merck Ltd.	1997-08-13	Not applicable
Profasi HP 10000	Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)	Kit; Liquid; Powder, for solution	Intramuscular; Subcutaneous	Emd Serono, A Division Of Emd Inc., Canada	1991-12-31	2007-05-07

Categories

UNII

20ED16GHEB

CAS number

9002-61-3

Pharmacology

Indication

For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.

Associated Conditions

Associated Therapies

Pharmacodynamics

The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.

Mechanism of action

Target	Actions	Organism
ALutropin-choriogonadotropic hormone receptor	ligand	Humans

Unlock Additional Data

Additional Data Available

Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more

Additional Data Available

Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more

Additional Data Available

Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more

Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism

Not Available

Route of elimination

Not Available

Half life

Not Available

Clearance

Not Available

Toxicity

Not Available

Affected organisms

Not Available

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions: This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions: Not Available

References

General References

Not Available

External Links

KEGG Drug: D06457
PubChem Substance: 347910414
ChEBI: 81570
ChEMBL: CHEMBL1201509
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Human_chorionic_gonadotropin

ATC Codes

G03GA01 — Chorionic gonadotrophin

AHFS Codes

68:18.00 — Gonadotropins and Antigonadotropins

FDA label

Download (26.7 KB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Completed	Basic Science	Polycystic Ovaries Syndrome	1
0	Completed	Screening	Infertility	1
0	Completed	Treatment	Spontaneous Triggering of Ovulation vs. Administration of Human Chorionic Gonadotropin in Patients Undergoing IUI	1
1	Completed	Treatment	Infertility	1
1, 2	Completed	Prevention	Endocrine System Diseases / Gonadal Disorders	1
1, 2	Completed	Treatment	Healthy Males	1
1, 2	Completed	Treatment	HCG	1
1, 2	Recruiting	Supportive Care	Graft Versus Host Disease (GVHD)	1
1, 2	Unknown Status	Treatment	Assisted Reproductive Technology therapy	1
2	Completed	Treatment	Assisted Reproductive Technology therapy / Infertility	1
2	Completed	Treatment	Fertility Agents, Female	1
2	Completed	Treatment	Infertility	1
2	Completed	Treatment	Ovarian Response	1
2	Not Yet Recruiting	Treatment	Acquired Hypogonadotropic Hypogonadism	1
2	Not Yet Recruiting	Treatment	Anovulatory cycle / Polycystic Ovaries Syndrome	1
2	Not Yet Recruiting	Treatment	Pituitary gonadotropin hypofunction	1
2	Recruiting	Treatment	Azoospermia	1
2	Terminated	Treatment	Ovulation induction therapy	2
2	Terminated	Treatment	Stroke	1
2, 3	Completed	Treatment	Infertility	1
3	Active Not Recruiting	Treatment	Idiopathic Hypogonadotropic Hypogonadism	1
3	Completed	Not Available	Ovarian Stimulation	1
3	Completed	Diagnostic	Polycystic Ovarian Syndrome	1
3	Completed	Diagnostic	Polycystic Ovaries Syndrome	1
3	Completed	Treatment	Anovulatory cycle / Hypothalamic-pituitary Dysfunction / Oligo-ovulation / Polycystic Ovarian Syndrome	1
3	Completed	Treatment	Assisted Reproductive Techniques / Reproductive Technology, Assisted	1
3	Completed	Treatment	Assisted Reproductive Technology therapy	2
3	Completed	Treatment	Embryo Transfer / Luteal Hormone Supplementation in In-vitro Fertilization	1
3	Completed	Treatment	Hypogonadism	1
3	Completed	Treatment	Hypogonadism / Idiopathic Hypogonadotropic Hypogonadism	1
3	Completed	Treatment	Increase Pregnancy Rate	1
3	Completed	Treatment	Infertility	4
3	Completed	Treatment	Unexplained Infertility	1
3	Not Yet Recruiting	Treatment	In-Vitro Fertilization	1
3	Recruiting	Treatment	HCG; IVF; Pregnancy Rates; ART; Chorionic Gonadotropin	1
3	Recruiting	Treatment	Ovulatory Dysfunction	1
3	Terminated	Supportive Care	Fertility / Follicle Stimulating Hormone Deficiency / Infertility	1
3	Unknown Status	Treatment	Embryonic Development / Pregnancy / VEGF	1
3	Withdrawn	Treatment	Infertility	1
4	Active Not Recruiting	Treatment	Infertility	1
4	Completed	Not Available	Infertility / Premature Ovarian Failure (POF)	1
4	Completed	Basic Science	Controlled Ovarian Stimulation / Infertility	1
4	Completed	Basic Science	Infertility / Subfertility	1
4	Completed	Treatment	Assisted Reproduction	1
4	Completed	Treatment	Fertility / Optimal Stimulation Protocol / Reproductive Endocrinology	1
4	Completed	Treatment	Idiopathic Hypogonadotropic Hypogonadism	1
4	Completed	Treatment	Idiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia	1
4	Completed	Treatment	Infertile Women Undergoing Assisted Reproductive Technology (ART)	1
4	Completed	Treatment	Infertility	10
4	Completed	Treatment	OHSS (Ovarian Hyperstimulation)	1
4	Completed	Treatment	Ovarian Hyperstimulation Syndrome	1
4	Completed	Treatment	Ovarian Response	1
4	Completed	Treatment	Pregnancy	1
4	Completed	Treatment	Supervision of Pregnancy Resulting From In-vitro Fertilization	1
4	Not Yet Recruiting	Supportive Care	Intrauterine Insemination	1
4	Not Yet Recruiting	Treatment	Infertility / Isolated Hypogonadotropic Hypogonadism / Olfacto genital dysplasia	1
4	Recruiting	Diagnostic	Ovarian Reserve	1
4	Recruiting	Supportive Care	Infertility	2
4	Recruiting	Treatment	Abortions spontaneous / Egg Retrieval / IVF Cycle / Ovarian Hyperstimulation / Ovarian Stimulation / Pregnancy	1
4	Recruiting	Treatment	Idiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia	1
4	Recruiting	Treatment	Infertility	3
4	Recruiting	Treatment	Infertility / Polycystic Ovarian Syndrome	1
4	Terminated	Diagnostic	Endometrial Receptivity / Ovarian Hyperstimulation Syndrome	1
4	Terminated	Treatment	Idiopathic Hypogonadotropic Hypogonadism	1
4	Unknown Status	Treatment	Endometrial Thickness / Pregnancy Outcomes	1
4	Unknown Status	Treatment	Idiopathic Hypogonadotropic Hypogonadism	1
4	Unknown Status	Treatment	Infertility	1
4	Unknown Status	Treatment	Infertility / Invitro Fertilization	1
4	Withdrawn	Treatment	Infertility / Polycystic Ovarian Syndrome	1
Not Available	Active Not Recruiting	Not Available	Testicular Hypogonadism	1
Not Available	Active Not Recruiting	Basic Science	Calcium Disorder / Hypogonadism / Kidney Diseases	1
Not Available	Completed	Not Available	534 Patients in the Cases Group and 580 Women in the Control Group Received no Measures, While 579 Patients Received Drugs / At the Same Time, the Investigators Continuedly Collect Cases to October 2012, and Totally Collected 579 Patients With PCOS Altogether / The Investigators Collected 534 PCOS Patients as the Case Group,and 580 Infertile Women With Normal Ovulatory Cycle of the Control Group / The Investigators Monitored Basic Indexes in Blood of All the Subjects in This Suvey,and Also Monitored Indexes of 579 Patients After Treatment	1
Not Available	Completed	Not Available	Human Chorionic Gonadotropin (hCG) Stimulation / Klinefelter's Syndrome / Steroidogenesis	1
Not Available	Completed	Not Available	Idiopathic Hypogonadotropic Hypogonadism	2
Not Available	Completed	Not Available	Infertility / Ovulation induction therapy	1
Not Available	Completed	Diagnostic	Hypogonadism / Spinal Cord Injuries (SCI)	1
Not Available	Completed	Diagnostic	Infertility	2
Not Available	Completed	Screening	Polycystic Ovaries Syndrome	1
Not Available	Completed	Treatment	Infertility	3
Not Available	Completed	Treatment	Infertility / OHSS	1
Not Available	Completed	Treatment	Ovulation induction therapy	1
Not Available	Completed	Treatment	Poor Responders	1
Not Available	Completed	Treatment	Repeated Implantation Failure	1
Not Available	Completed	Treatment	Subfertility	1
Not Available	Not Yet Recruiting	Diagnostic	Assisted Reproduction / Female Infertility	1
Not Available	Not Yet Recruiting	Treatment	Assisted Reproductive Technology therapy / Female Infertility / Oocytes / Ovulation induction therapy	1
Not Available	Not Yet Recruiting	Treatment	Fibroid Uterus / IVF	1
Not Available	Not Yet Recruiting	Treatment	Infertility	1
Not Available	Not Yet Recruiting	Treatment	Ovulatory Dysfunction / Subfertility, Female	1
Not Available	Not Yet Recruiting	Treatment	Unexplained Infertility	1
Not Available	Recruiting	Diagnostic	Invitro Fertilization	1
Not Available	Recruiting	Health Services Research	Congenital Uterine Anomalies / Endometriosis / Extrauterine Pregnancy / Female Infertility / Female Infertility - Cervical/Vaginal / Female Infertility Due to Ovulatory Disorder / Female Infertility Due to Tubal Block / Female Infertility Due to Tubal Occlusion / Female Infertility Endocrine / Female Infertility of Other Origin / Female Infertility of Tubal Origin / Hydrosalpinx / Infections Uterine / Leiomyomas / Polycystic Ovaries Syndrome / Premature Ovarian Failure (POF) / Salpingitis	1
Not Available	Recruiting	Other	Embryonic Quality Using MitoScore (DuoStim x Conventional Stimulation Protocol) / Female Infertility / Potential Usefulness of the DuoStim Protocol / Rate of Euploid Embryos Per Cycle (DuoStim x Conventional Stimulation Protocol)	1
Not Available	Recruiting	Prevention	ART / Infertility	1
Not Available	Recruiting	Treatment	Infertility	1
Not Available	Terminated	Prevention	BRCA1 Mutations / Breast Cancer	1
Not Available	Unknown Status	Prevention	Infertility and at High Risk of OHSS	1
Not Available	Unknown Status	Treatment	Assisted Reproductive Technology therapy / Poor Responder	1
Not Available	Unknown Status	Treatment	Infertility	2
Not Available	Withdrawn	Treatment	Infertility	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage forms

Form	Route	Strength
Liquid; powder, for solution	Intramuscular
Liquid	Intramuscular
Powder, for solution	Intramuscular; Subcutaneous
Powder	Not applicable	1 g/1g
Kit; liquid; powder, for solution	Intramuscular
Kit; liquid; powder, for solution	Intramuscular; Subcutaneous
Powder, for solution	Intramuscular

Prices

Not Available

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
Unlock Additional Data
US6706681	No	2004-03-16	2021-03-16

Additional Data Available

Filed On

The date on which a patent was filed with the relevant government.

Learn more

Properties

State: Solid
Experimental Properties: Not Available

Taxonomy

Description: Not Available
Kingdom: Organic Compounds
Super Class: Organic Acids
Class: Carboxylic Acids and Derivatives
Sub Class: Amino Acids, Peptides, and Analogues
Direct Parent: Peptides
Alternative Parents: Not Available
Substituents: Not Available
Molecular Framework: Not Available
External Descriptors: Not Available

Targets

Details1. Lutropin-choriogonadotropic hormone receptor

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Ligand

General Function: Luteinizing hormone receptor activity
Specific Function: Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name: LHCGR
Uniprot ID: P22888
Uniprot Name: Lutropin-choriogonadotropic hormone receptor
Molecular Weight: 78642.01 Da

Drug created on September 23, 2015 10:50 / Updated on December 11, 2019 03:49