Chorionic Gonadotropin (Human)

Identification

Name
Chorionic Gonadotropin (Human)
Accession Number
DB09126
Type
Biotech
Groups
Approved, Vet approved
Biologic Classification
Protein Based Therapies
Hormones
Description

Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens.

HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub­ units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub­ units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females.

Protein structure
Db09126
Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>Alpha Chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta Chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format
Synonyms
  • Chorionic gonadotrophin
  • Chorionic gonadotropin
  • Gonadotropin, Chorionic
  • Gonadotropin,chorionic
  • h-HCG
  • hCG
  • Human chorionic gonadotropin
  • Human menopausal gonadotropin
  • Human menopausal gonadotropin (urine derived)
  • Human-chorionic gonadotropin
  • Urinary hCG
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Apl Inj 1000 Iu/mlLiquid1000 unitIntramuscularAyerst Laboratories1951-12-312000-08-02Canada
Chorionic Gonadotropin for Injection, USPPowder, for solution10000 unitIntramuscular; SubcutaneousFresenius Kabi2004-09-13Not applicableCanada
NovarelKit10000 [USP'U]/1Ferring Pharmaceuticals Inc.1974-01-15Not applicableUs
NovarelKit5000 [USP'U]/1Ferring Pharmaceuticals Inc.1974-01-15Not applicableUs
Profasi Hp Inj 10000unit/vial USPPowder, for solution10000 unitIntramuscularPharmascience Inc1984-12-312009-04-29Canada
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
A.P.L. - Pws-liqChorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Liquid; Powder, for solutionIntramuscularWyeth Ayerst Canada Inc.1998-11-112001-06-01Canada
PregnylChorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Kit; Liquid; Powder, for solutionIntramuscularMerck Ltd.1997-08-13Not applicableCanada
Profasi Hp 10000Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Kit; Liquid; Powder, for solutionIntramuscular; SubcutaneousEmd Serono, A Division Of Emd Inc., Canada1991-12-312007-05-07Canada
Categories
UNII
20ED16GHEB
CAS number
9002-61-3

Pharmacology

Indication

For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.

Associated Conditions
Associated Therapies
Pharmacodynamics

The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.

Mechanism of action
TargetActionsOrganism
ALutropin-choriogonadotropic hormone receptor
ligand
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
Not Available
Food Interactions
Not Available

References

General References
Not Available
External Links
KEGG Drug
D06457
PubChem Substance
347910414
ChEBI
81570
ChEMBL
CHEMBL1201509
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Human_chorionic_gonadotropin
ATC Codes
G03GA01 — Chorionic gonadotrophin
AHFS Codes
  • 68:18.00 — Gonadotropins
FDA label
Download (26.7 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedBasic SciencePolycystic Ovaries Syndrome1
0CompletedTreatmentSpontaneous Triggering of Ovulation vs. Administration of Human Chorionic Gonadotropin in Patients Undergoing IUI1
1, 2CompletedPreventionEndocrine System Diseases / Gonadal Disorders1
1, 2CompletedTreatmentHealthy Males1
1, 2CompletedTreatmentHCG1
1, 2RecruitingSupportive CareGraft Versus Host Disease (GVHD)1
1, 2Unknown StatusTreatmentAssisted Reproductive Technology therapy1
2CompletedTreatmentAssisted Reproductive Technology therapy / Infertilities1
2CompletedTreatmentInfertilities1
2Not Yet RecruitingTreatmentAnovulatory cycle / Polycystic Ovaries Syndrome1
2Not Yet RecruitingTreatmentPituitary gonadotropin hypofunction1
2TerminatedTreatmentOvulation induction therapy1
3CompletedTreatmentAnovulatory cycle / Hypothalamic-pituitary Dysfunction / Oligo-ovulation / Polycystic Ovarian Syndrome1
3CompletedTreatmentAssisted Reproductive Technology therapy1
3CompletedTreatmentEmbryo Transfer / Luteal Hormone Supplementation in In-vitro Fertilization1
3CompletedTreatmentHypogonadism1
3CompletedTreatmentHypogonadism / Idiopathic Hypogonadotropic Hypogonadism1
3CompletedTreatmentInfertilities2
3CompletedTreatmentUnexplained Infertility1
3RecruitingTreatmentHCG; IVF; Pregnancy Rates; ART; Chorionic Gonadotropin1
3RecruitingTreatmentOvulatory Dysfunction1
3Unknown StatusPreventionCancer, Breast1
3Unknown StatusTreatmentEmbryonic Development / Pregnancy / VEGF1
3WithdrawnTreatmentInfertilities1
4Active Not RecruitingTreatmentInfertilities1
4CompletedNot AvailableInfertilities / Premature Ovarian Failure (POF)1
4CompletedBasic ScienceInfertilities / Subfertility1
4CompletedTreatmentFertility / Optimal Stimulation Protocol / Reproductive Endocrinology1
4CompletedTreatmentInfertile Women Undergoing Assisted Reproductive Technology (ART)1
4CompletedTreatmentInfertilities9
4CompletedTreatmentOHSS (Ovarian Hyperstimulation)1
4CompletedTreatmentOvarian Hyperstimulation Syndrome1
4CompletedTreatmentOvarian Response1
4CompletedTreatmentPregnancy1
4Not Yet RecruitingDiagnosticOvarian Reserve1
4Not Yet RecruitingTreatmentInfertilities / Isolated Hypogonadotropic Hypogonadism / Olfacto genital dysplasia1
4RecruitingSupportive CareInfertilities2
4RecruitingTreatmentEmbryo Transfer / Luteal Support1
4RecruitingTreatmentIdiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia1
4RecruitingTreatmentInfertilities5
4RecruitingTreatmentInfertilities / Polycystic Ovarian Syndrome1
4RecruitingTreatmentLUF - Luteinised Unruptured Follicle Syndrome1
4TerminatedTreatmentIdiopathic Hypogonadotropic Hypogonadism1
4Unknown StatusTreatmentEndometrial Thickness / Pregnancy Outcomes1
4Unknown StatusTreatmentIdiopathic Hypogonadotropic Hypogonadism1
4Unknown StatusTreatmentInfertilities1
4Unknown StatusTreatmentInfertilities / Invitro Fertilization1
4Unknown StatusTreatmentOvarian Hyperstimulation Syndrome1
4Unknown StatusTreatmentSupervision of Pregnancy Resulting From In-vitro Fertilization1
4WithdrawnTreatmentInfertilities / Polycystic Ovarian Syndrome1
Not AvailableCompletedNot AvailableHuman Chorionic Gonadotropin (hCG) Stimulation / Klinefelter's Syndrome / Steroidogenesis1
Not AvailableCompletedDiagnosticHypogonadism / Spinal Cord Injuries (SCI)1
Not AvailableCompletedDiagnosticInfertilities1
Not AvailableCompletedDiagnosticPolycystic Ovaries Syndrome1
Not AvailableCompletedTreatmentInfertilities3
Not AvailableCompletedTreatmentInfertilities / OHSS1
Not AvailableCompletedTreatmentPoor Responders1
Not AvailableCompletedTreatmentRepeated Implantation Failure1
Not AvailableNot Yet RecruitingTreatmentAssisted Reproductive Technology therapy / Infertility, Female / Oocytes / Ovulation induction therapy1
Not AvailableNot Yet RecruitingTreatmentInfertilities1
Not AvailableNot Yet RecruitingTreatmentOvulatory Dysfunction / Subfertility, Female1
Not AvailableNot Yet RecruitingTreatmentUnexplained Infertility1
Not AvailableRecruitingNot AvailablePoor Ovarian Response1
Not AvailableRecruitingNot AvailableTesticular Hypogonadism1
Not AvailableRecruitingBasic ScienceCalcium Disorder / Hypogonadism / Kidney Diseases1
Not AvailableRecruitingDiagnosticIVF Treatment1
Not AvailableRecruitingDiagnosticInvitro Fertilization1
Not AvailableRecruitingOtherEmbryonic Quality Using MitoScore (DuoStim x Conventional Stimulation Protocol) / Infertility, Female / Potential Usefulness of the DuoStim Protocol / Rate of Euploid Embryos Per Cycle (DuoStim x Conventional Stimulation Protocol)1
Not AvailableRecruitingPreventionART / Infertilities1
Not AvailableRecruitingTreatmentInfertilities1
Not AvailableUnknown StatusDiagnosticEndometrial Receptivity / Ovarian Hyperstimulation Syndrome1
Not AvailableUnknown StatusPreventionInfertility and at High Risk of OHSS1
Not AvailableUnknown StatusTreatmentInfertilities1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Liquid; powder, for solutionIntramuscular
LiquidIntramuscular1000 unit
Powder, for solutionIntramuscular; Subcutaneous10000 unit
Kit10000 [USP'U]/1
Kit5000 [USP'U]/1
Kit; liquid; powder, for solutionIntramuscular
Kit; liquid; powder, for solutionIntramuscular; Subcutaneous
Powder, for solutionIntramuscular10000 unit
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US6706681No2001-03-162021-03-16Us

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Ligand
General Function
Luteinizing hormone receptor activity
Specific Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name
LHCGR
Uniprot ID
P22888
Uniprot Name
Lutropin-choriogonadotropic hormone receptor
Molecular Weight
78642.01 Da

Drug created on September 23, 2015 10:50 / Updated on October 21, 2018 20:36