Chorionic Gonadotropin (Human)
Identification
- Name
- Chorionic Gonadotropin (Human)
- Accession Number
- DB09126
- Type
- Biotech
- Groups
- Approved, Vet approved
- Biologic Classification
- Protein Based Therapies
Hormones - Description
Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens.
HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females.
- Protein structure
- Protein chemical formula
- Not Available
- Protein average weight
- Not Available
- Sequences
>Alpha Chain APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta Chain SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format- Synonyms
- Chorionic gonadotrophin
- Chorionic gonadotropin
- Gonadotropin, Chorionic
- Gonadotropin,chorionic
- h-HCG
- hCG
- Human chorionic gonadotropin
- Human menopausal gonadotropin
- Human menopausal gonadotropin (urine derived)
- Human-chorionic gonadotropin
- Urinary hCG
- Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Unlock Additional DataApl Inj 1000 Iu/ml Liquid Intramuscular Ayerst Laboratories 1951-12-31 2000-08-02 Canada Chorionic Gonadotropin for Injection, USP Powder, for solution Intramuscular; Subcutaneous Fresenius Kabi 2004-09-13 Not applicable Canada Novarel 5000 [USP'U]/1 Intramuscular Ferring Pharmaceuticals Inc. 1974-01-15 Not applicable US Novarel 10000 [USP'U]/1 Intramuscular Ferring Pharmaceuticals Inc. 1974-01-15 Not applicable US Profasi Hp Inj 10000unit/vial USP Powder, for solution Intramuscular Pharmascience Inc 1984-12-31 2009-04-29 Canada Additional Data Available- Application NumberApplication Number
A unique ID assigned by the FDA when a product is submitted for approval by the labeller.
Learn more - Product CodeProduct Code
A governmentally-recognized ID which uniquely identifies the product within its regulatory market.
Learn more
- Mixture Products
Name Ingredients Dosage Route Labeller Marketing Start Marketing End A.P.L. - Pws-liq Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml) Liquid; Powder, for solution Intramuscular Wyeth Ayerst Canada Inc. 1998-11-11 2001-06-01 Canada Pregnyl Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml) Kit; Liquid; Powder, for solution Intramuscular Merck Ltd. 1997-08-13 Not applicable Canada Profasi HP 10000 Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml) Kit; Liquid; Powder, for solution Intramuscular; Subcutaneous Emd Serono, A Division Of Emd Inc., Canada 1991-12-31 2007-05-07 Canada - Categories
- Amino Acids, Peptides, and Proteins
- Chorionic Gonadotropin
- Genito Urinary System and Sex Hormones
- Gonadotropins
- Gonadotropins and Antigonadotropins
- Hormones
- Hormones, Hormone Substitutes, and Hormone Antagonists
- Peptide Hormones
- Peptides
- Placental Hormones
- Pregnancy Proteins
- Proteins
- Reproductive Control Agents
- Sex Hormones and Modulators of the Genital System
- UNII
- 20ED16GHEB
- CAS number
- 9002-61-3
Pharmacology
- Indication
For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.
- Associated Conditions
- Associated Therapies
- Pharmacodynamics
The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.
- Mechanism of action
Target Actions Organism ALutropin-choriogonadotropic hormone receptor ligandHumans - Absorption
- Not Available
- Volume of distribution
- Not Available
- Protein binding
- Not Available
- Metabolism
- Not Available
- Route of elimination
- Not Available
- Half life
- Not Available
- Clearance
- Not Available
- Toxicity
- Not Available
- Affected organisms
- Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.
Learn moreStructured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.
Learn moreStructured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.
Learn moreInteractions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
- Not Available
References
- General References
- Not Available
- External Links
- KEGG Drug
- D06457
- PubChem Substance
- 347910414
- ChEBI
- 81570
- ChEMBL
- CHEMBL1201509
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Human_chorionic_gonadotropin
- ATC Codes
- G03GA01 — Chorionic gonadotrophin
- AHFS Codes
- 68:18.00 — Gonadotropins and Antigonadotropins
- FDA label
- Download (26.7 KB)
Clinical Trials
- Clinical Trials
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage forms
Form Route Strength Liquid; powder, for solution Intramuscular Liquid Intramuscular Powder, for solution Intramuscular; Subcutaneous Powder Not applicable 1 g/1g Kit; liquid; powder, for solution Intramuscular Kit; liquid; powder, for solution Intramuscular; Subcutaneous Powder, for solution Intramuscular - Prices
- Not Available
- Patents
Patent Number Pediatric Extension Approved Expires (estimated) Unlock Additional DataUS6706681 No 2004-03-16 2021-03-16 US Additional Data Available- Filed On
Properties
- State
- Solid
- Experimental Properties
- Not Available
Taxonomy
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Ligand
- General Function
- Luteinizing hormone receptor activity
- Specific Function
- Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
- Gene Name
- LHCGR
- Uniprot ID
- P22888
- Uniprot Name
- Lutropin-choriogonadotropic hormone receptor
- Molecular Weight
- 78642.01 Da
Drug created on September 23, 2015 10:50 / Updated on December 11, 2019 03:49