Chorionic Gonadotropin (Human)

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates
Name
Chorionic Gonadotropin (Human)
Accession Number
DB09126
Type
Biotech
Groups
Approved, Vet approved
Biologic Classification
Protein Based Therapies
Hormones
Description

Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens.

HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub­ units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub­ units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females.

Protein structure
Db09126
Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>Alpha Chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta Chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format
Synonyms
  • Chorionic gonadotrophin
  • Chorionic gonadotropin
  • Gonadotropin, Chorionic
  • Gonadotropin,chorionic
  • h-HCG
  • hCG
  • Human chorionic gonadotropin
  • Human menopausal gonadotropin
  • Human menopausal gonadotropin (urine derived)
  • Human-chorionic gonadotropin
  • Urinary hCG
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Apl Inj 1000 Iu/mlLiquidIntramuscularAyerst Laboratories1951-12-312000-08-02Canada
Chorionic Gonadotropin for Injection, USPPowder, for solutionIntramuscular; SubcutaneousFresenius Kabi2004-09-13Not applicableCanada
Novarel5000 [USP'U]/1IntramuscularFerring Pharmaceuticals Inc.1974-01-15Not applicableUs
Novarel10000 [USP'U]/1IntramuscularFerring Pharmaceuticals Inc.1974-01-15Not applicableUs
Profasi Hp Inj 10000unit/vial USPPowder, for solutionIntramuscularPharmascience Inc1984-12-312009-04-29Canada
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
A.P.L. - Pws-liqChorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Liquid; Powder, for solutionIntramuscularWyeth Ayerst Canada Inc.1998-11-112001-06-01Canada
PregnylChorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Kit; Liquid; Powder, for solutionIntramuscularMerck Ltd.1997-08-13Not applicableCanada
Profasi HP 10000Chorionic Gonadotropin (Human) (10000 unit) + Water (10 ml)Kit; Liquid; Powder, for solutionIntramuscular; SubcutaneousEmd Serono, A Division Of Emd Inc., Canada1991-12-312007-05-07Canada
Categories
UNII
20ED16GHEB
CAS number
9002-61-3

Pharmacology

Indication

For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.

Associated Conditions
Associated Therapies
Pharmacodynamics

The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.

Mechanism of action
TargetActionsOrganism
ALutropin-choriogonadotropic hormone receptor
ligand
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions
Not Available

References

General References
Not Available
External Links
KEGG Drug
D06457
PubChem Substance
347910414
ChEBI
81570
ChEMBL
CHEMBL1201509
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Human_chorionic_gonadotropin
ATC Codes
G03GA01 — Chorionic gonadotrophin
AHFS Codes
  • 68:18.00 — Gonadotropins and Antigonadotropins
FDA label
Download (26.7 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedBasic SciencePolycystic Ovaries Syndrome1
0CompletedScreeningInfertility1
0CompletedTreatmentSpontaneous Triggering of Ovulation vs. Administration of Human Chorionic Gonadotropin in Patients Undergoing IUI1
1CompletedTreatmentInfertility1
1, 2CompletedPreventionEndocrine System Diseases / Gonadal Disorders1
1, 2CompletedTreatmentHealthy Males1
1, 2CompletedTreatmentHCG1
1, 2RecruitingSupportive CareGraft Versus Host Disease (GVHD)1
1, 2Unknown StatusTreatmentAssisted Reproductive Technology therapy1
2CompletedTreatmentAssisted Reproductive Technology therapy / Infertility1
2CompletedTreatmentFertility Agents, Female1
2CompletedTreatmentInfertility1
2CompletedTreatmentOvarian Response1
2Not Yet RecruitingTreatmentAcquired Hypogonadotropic Hypogonadism1
2Not Yet RecruitingTreatmentAnovulatory cycle / Polycystic Ovaries Syndrome1
2Not Yet RecruitingTreatmentPituitary gonadotropin hypofunction1
2RecruitingTreatmentAzoospermia1
2TerminatedTreatmentOvulation induction therapy2
2TerminatedTreatmentStroke1
2, 3CompletedTreatmentInfertility1
3Active Not RecruitingTreatmentIdiopathic Hypogonadotropic Hypogonadism1
3CompletedNot AvailableOvarian Stimulation1
3CompletedDiagnosticPolycystic Ovarian Syndrome1
3CompletedDiagnosticPolycystic Ovaries Syndrome1
3CompletedTreatmentAnovulatory cycle / Hypothalamic-pituitary Dysfunction / Oligo-ovulation / Polycystic Ovarian Syndrome1
3CompletedTreatmentAssisted Reproductive Techniques / Reproductive Technology, Assisted1
3CompletedTreatmentAssisted Reproductive Technology therapy2
3CompletedTreatmentEmbryo Transfer / Luteal Hormone Supplementation in In-vitro Fertilization1
3CompletedTreatmentHypogonadism1
3CompletedTreatmentHypogonadism / Idiopathic Hypogonadotropic Hypogonadism1
3CompletedTreatmentIncrease Pregnancy Rate1
3CompletedTreatmentInfertility4
3CompletedTreatmentUnexplained Infertility1
3Not Yet RecruitingTreatmentIn-Vitro Fertilization1
3RecruitingTreatmentHCG; IVF; Pregnancy Rates; ART; Chorionic Gonadotropin1
3RecruitingTreatmentOvulatory Dysfunction1
3TerminatedSupportive CareFertility / Follicle Stimulating Hormone Deficiency / Infertility1
3Unknown StatusTreatmentEmbryonic Development / Pregnancy / VEGF1
3WithdrawnTreatmentInfertility1
4Active Not RecruitingTreatmentInfertility1
4CompletedNot AvailableInfertility / Premature Ovarian Failure (POF)1
4CompletedBasic ScienceControlled Ovarian Stimulation / Infertility1
4CompletedBasic ScienceInfertility / Subfertility1
4CompletedTreatmentAssisted Reproduction1
4CompletedTreatmentFertility / Optimal Stimulation Protocol / Reproductive Endocrinology1
4CompletedTreatmentIdiopathic Hypogonadotropic Hypogonadism1
4CompletedTreatmentIdiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia1
4CompletedTreatmentInfertile Women Undergoing Assisted Reproductive Technology (ART)1
4CompletedTreatmentInfertility10
4CompletedTreatmentOHSS (Ovarian Hyperstimulation)1
4CompletedTreatmentOvarian Hyperstimulation Syndrome1
4CompletedTreatmentOvarian Response1
4CompletedTreatmentPregnancy1
4CompletedTreatmentSupervision of Pregnancy Resulting From In-vitro Fertilization1
4Not Yet RecruitingSupportive CareIntrauterine Insemination1
4Not Yet RecruitingTreatmentInfertility / Isolated Hypogonadotropic Hypogonadism / Olfacto genital dysplasia1
4RecruitingDiagnosticOvarian Reserve1
4RecruitingSupportive CareInfertility2
4RecruitingTreatmentAbortions spontaneous / Egg Retrieval / IVF Cycle / Ovarian Hyperstimulation / Ovarian Stimulation / Pregnancy1
4RecruitingTreatmentIdiopathic Hypogonadotropic Hypogonadism / Olfacto genital dysplasia1
4RecruitingTreatmentInfertility3
4RecruitingTreatmentInfertility / Polycystic Ovarian Syndrome1
4TerminatedDiagnosticEndometrial Receptivity / Ovarian Hyperstimulation Syndrome1
4TerminatedTreatmentIdiopathic Hypogonadotropic Hypogonadism1
4Unknown StatusTreatmentEndometrial Thickness / Pregnancy Outcomes1
4Unknown StatusTreatmentIdiopathic Hypogonadotropic Hypogonadism1
4Unknown StatusTreatmentInfertility1
4Unknown StatusTreatmentInfertility / Invitro Fertilization1
4WithdrawnTreatmentInfertility / Polycystic Ovarian Syndrome1
Not AvailableActive Not RecruitingNot AvailableTesticular Hypogonadism1
Not AvailableActive Not RecruitingBasic ScienceCalcium Disorder / Hypogonadism / Kidney Diseases1
Not AvailableCompletedNot Available534 Patients in the Cases Group and 580 Women in the Control Group Received no Measures, While 579 Patients Received Drugs / At the Same Time, the Investigators Continuedly Collect Cases to October 2012, and Totally Collected 579 Patients With PCOS Altogether / The Investigators Collected 534 PCOS Patients as the Case Group,and 580 Infertile Women With Normal Ovulatory Cycle of the Control Group / The Investigators Monitored Basic Indexes in Blood of All the Subjects in This Suvey,and Also Monitored Indexes of 579 Patients After Treatment1
Not AvailableCompletedNot AvailableHuman Chorionic Gonadotropin (hCG) Stimulation / Klinefelter's Syndrome / Steroidogenesis1
Not AvailableCompletedNot AvailableIdiopathic Hypogonadotropic Hypogonadism2
Not AvailableCompletedNot AvailableInfertility / Ovulation induction therapy1
Not AvailableCompletedDiagnosticHypogonadism / Spinal Cord Injuries (SCI)1
Not AvailableCompletedDiagnosticInfertility2
Not AvailableCompletedScreeningPolycystic Ovaries Syndrome1
Not AvailableCompletedTreatmentInfertility3
Not AvailableCompletedTreatmentInfertility / OHSS1
Not AvailableCompletedTreatmentOvulation induction therapy1
Not AvailableCompletedTreatmentPoor Responders1
Not AvailableCompletedTreatmentRepeated Implantation Failure1
Not AvailableCompletedTreatmentSubfertility1
Not AvailableNot Yet RecruitingDiagnosticAssisted Reproduction / Female Infertility1
Not AvailableNot Yet RecruitingTreatmentAssisted Reproductive Technology therapy / Female Infertility / Oocytes / Ovulation induction therapy1
Not AvailableNot Yet RecruitingTreatmentFibroid Uterus / IVF1
Not AvailableNot Yet RecruitingTreatmentInfertility1
Not AvailableNot Yet RecruitingTreatmentOvulatory Dysfunction / Subfertility, Female1
Not AvailableNot Yet RecruitingTreatmentUnexplained Infertility1
Not AvailableRecruitingDiagnosticInvitro Fertilization1
Not AvailableRecruitingHealth Services ResearchCongenital Uterine Anomalies / Endometriosis / Extrauterine Pregnancy / Female Infertility / Female Infertility - Cervical/Vaginal / Female Infertility Due to Ovulatory Disorder / Female Infertility Due to Tubal Block / Female Infertility Due to Tubal Occlusion / Female Infertility Endocrine / Female Infertility of Other Origin / Female Infertility of Tubal Origin / Hydrosalpinx / Infections Uterine / Leiomyomas / Polycystic Ovaries Syndrome / Premature Ovarian Failure (POF) / Salpingitis1
Not AvailableRecruitingOtherEmbryonic Quality Using MitoScore (DuoStim x Conventional Stimulation Protocol) / Female Infertility / Potential Usefulness of the DuoStim Protocol / Rate of Euploid Embryos Per Cycle (DuoStim x Conventional Stimulation Protocol)1
Not AvailableRecruitingPreventionART / Infertility1
Not AvailableRecruitingTreatmentInfertility1
Not AvailableTerminatedPreventionBRCA1 Mutations / Breast Cancer1
Not AvailableUnknown StatusPreventionInfertility and at High Risk of OHSS1
Not AvailableUnknown StatusTreatmentAssisted Reproductive Technology therapy / Poor Responder1
Not AvailableUnknown StatusTreatmentInfertility2
Not AvailableWithdrawnTreatmentInfertility1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Liquid; powder, for solutionIntramuscular
LiquidIntramuscular
Powder, for solutionIntramuscular; Subcutaneous
PowderNot applicable1 g/1g
Kit; liquid; powder, for solutionIntramuscular
Kit; liquid; powder, for solutionIntramuscular; Subcutaneous
Powder, for solutionIntramuscular
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US6706681No2004-03-162021-03-16Us
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Ligand
General Function
Luteinizing hormone receptor activity
Specific Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name
LHCGR
Uniprot ID
P22888
Uniprot Name
Lutropin-choriogonadotropic hormone receptor
Molecular Weight
78642.01 Da

Drug created on September 23, 2015 10:50 / Updated on December 11, 2019 03:49