Tetanus Immune Globulin

Identification

Name
Tetanus Immune Globulin
Accession Number
DB11604
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Polyclonal antibody (pAb)
Description

Tetanus Immune Globulin is manufactured from human plasma [Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.

Protein structure
Db11604
Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>1AQK:H|PDBID|CHAIN|SEQUENCE
EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYY
ADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Download FASTA Format
Synonyms
  • Human clostridium tetani immune globulin
  • Human clostridium tetani toxoid immune globulin
  • Tetanus immune globulin human
  • Tetanus immune globulin, human
  • Tetanus immune globulin,human
  • Tetanus immunoglobulin
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HyperTET S/DSolution250 unitIntramuscularGrifols Therapeutics Inc.1997-07-08Not applicableCanada
HyperTET S/DInjection250 [iU]/1mLIntramuscularGRIFOLS USA, LLC1996-08-14Not applicableUs
HyperTET S/DSolution250 unitIntramuscularGrifols Therapeutics Inc.Not applicableNot applicableCanada
Categories
UNII
V4SWI4RF4J
CAS number
Not Available

Pharmacology

Indication

For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization statu [Label]. May also be used in the treatment of active tetanus.

Associated Conditions
Pharmacodynamics

Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [Label].

Mechanism of action

The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [1]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.

TargetActionsOrganism
ATetanus toxin
antibody
Clostridium tetani (strain Massachusetts / E88)
Absorption

Tmax for intramuscular administration is 2 days [Label].

Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

Half life is about 23 days [Label].

Clearance
Not Available
Toxicity

No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [Label].

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tetanus Immune Globulin.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Tetanus Immune Globulin.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Tetanus Immune Globulin.
Anthrax immune globulin humanThe therapeutic efficacy of Anthrax immune globulin human can be decreased when used in combination with Tetanus Immune Globulin.
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Tetanus Immune Globulin.
Bacillus calmette-guerin substrain connaught live antigenThe therapeutic efficacy of Bacillus calmette-guerin substrain connaught live antigen can be decreased when used in combination with Tetanus Immune Globulin.
Bacillus calmette-guerin substrain tice live antigenThe therapeutic efficacy of Bacillus calmette-guerin substrain tice live antigen can be decreased when used in combination with Tetanus Immune Globulin.
BasiliximabThe risk or severity of adverse effects can be increased when Basiliximab is combined with Tetanus Immune Globulin.
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Tetanus Immune Globulin.
BevacizumabThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Tetanus Immune Globulin.
Food Interactions
Not Available

References

General References
  1. Hassel B: Tetanus: pathophysiology, treatment, and the possibility of using botulinum toxin against tetanus-induced rigidity and spasms. Toxins (Basel). 2013 Jan 8;5(1):73-83. doi: 10.3390/toxins5010073. [PubMed:23299659]
External Links
PubChem Substance
347911214
ATC Codes
J06BB02 — Tetanus immunoglobulin
AHFS Codes
  • 80:04.00 — Serums
FDA label
Download (196 KB)
MSDS
Download (44.8 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4TerminatedPreventionTetanus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
InjectionIntramuscular250 [iU]/1mL
SolutionIntramuscular250 unit
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Clostridium tetani (strain Massachusetts / E88)
Pharmacological action
Yes
Actions
Antibody
General Function
Zinc ion binding
Specific Function
Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can ...
Gene Name
tetX
Uniprot ID
P04958
Uniprot Name
Tetanus toxin
Molecular Weight
150680.98 Da

Drug created on June 01, 2016 14:56 / Updated on October 16, 2018 08:43