Identification

Name
Avelumab
Accession Number
DB11945
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Avelumab is a programmed death ligand-1 (PD-L1) blocking antibody indicated for the treatment of adults and pediatric patients 12 years and older with metastatic Merkel cell carcinoma (MCC). It is a fully human anti-PD immunoglobulin G1 (IgG1) lambda monoclonal antibody with antineoplastic actions. It was granted accelerated approval in March 2017 under the name Bavencio.

Protein chemical formula
C6374H9898N1694O2010S44
Protein average weight
142.0 Da (approximate including glycans)
Sequences
>Heavy chain
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFY
ADTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light chain
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGV
SNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVLGQPKANPTVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Download FASTA Format
Synonyms
Not Available
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
BavencioSolution20 mgIntravenousEmd Serono, A Division Of Emd Inc., Canada2017-12-18Not applicableCanada
BavencioInjection, solution, concentrate20 mg/1mLIntravenousEMD Serono, Inc.2017-03-23Not applicableUs
Categories
UNII
KXG2PJ551I
CAS number
1537032-82-8

Pharmacology

Indication

Indicated for the treatment of adults and pediatric patients 12 years and older with metastatic Merkel cell carcinoma (MCC).

Associated Conditions
Pharmacodynamics

Avelumab is a whole antibody that binds the immunosuppressive programmed death-ligand 1 and inhibits the interaction between PD-1 and PD-L1. It prevents the formation of a PD-1/PD-L1 receptor/ligand complex that normally leads to inhibition of CD8+ T cells, and therefore inhibition of an immune reaction. Alevumab is an immunotherapeutic and antineoplastic agent that belongs to the group of immune checkpoint blockade cancer therapies. By retaining a native Fc-region, avelumab is thought to engage the innate immune system and may induce antibody-dependent cell-mediated cytotoxicity (ADCC).

Mechanism of action

PD-L1 may be expressed on tumor cells and tumor-infiltrating immune cells and can contribute to the inhibition of the anti-tumor immune response in the tumor microenvironment. Binding of PD-L1 to the PD-1 and B7.1 receptors found on T cells and antigen presenting cells suppresses cytotoxic T-cell activity, T-cell proliferation and cytokine production. Avelumab binds PD-L1 through the FG loops [7] and blocks the interaction between PD-L1 and its receptors PD-1 and B7.1. This interaction releases the inhibitory effects of PD-L1 on the immune response resulting in the restoration of immune responses, including anti-tumor immune responses. Avelumab has also been shown to induce antibody-dependent cell-mediated cytotoxicity (ADCC) in vitro. In syngeneic mouse tumor models, blocking PD-L1 activity resulted in decreased tumor growth.

TargetActionsOrganism
AProgrammed cell death 1 ligand 1
antagonist
Human
Absorption

The exposure of avelumab increased dose-proportionally in the dose range of 10 to 20 mg/kg every 2 weeks. Steady-state concentrations of avelumab were reached after approximately 4 to 6 weeks (2 to 3 cycles) of repeated dosing, and the systemic accumulation was approximately 1.25-fold.

Volume of distribution

The geometric mean volume of distribution at steady state for a subject receiving 10 mg/kg is 4.72 L.

Protein binding

None reported.

Metabolism

Avelumab undergoes nonspecific proteolytic degradation.

Route of elimination

Mainly eliminated through proteolytic degradation.

Half life

The terminal half-life is approximately 6.1 days in patients receiving 10 mg/kg.

Clearance

The total systemic clearance is approximately 0.59 L/day.

Toxicity

The most common serious adverse reactions to avelumab are immune-mediated adverse reactions (pneumonitis, hepatitis, colitis, adrenal insufficiency, hypo- and hyperthyroidism, diabetes mellitus, and nephritis) and life-threatening infusion reactions. Other common adverse effects include fatigue, musculoskeletal pain, diarrhea, nausea, infusion-related reaction, rash, decreased appetite, and peripheral edema.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Avelumab.
AbituzumabThe risk or severity of adverse effects can be increased when Avelumab is combined with Abituzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Avelumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Avelumab.
AducanumabThe risk or severity of adverse effects can be increased when Avelumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Avelumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Avelumab.
AlirocumabThe risk or severity of adverse effects can be increased when Alirocumab is combined with Avelumab.
AmatuximabThe risk or severity of adverse effects can be increased when Avelumab is combined with Amatuximab.
AMG 108The risk or severity of adverse effects can be increased when AMG 108 is combined with Avelumab.
Food Interactions
Not Available

References

General References
  1. Hamid O, Robert C, Daud A, Hodi FS, Hwu WJ, Kefford R, Wolchok JD, Hersey P, Joseph RW, Weber JS, Dronca R, Gangadhar TC, Patnaik A, Zarour H, Joshua AM, Gergich K, Elassaiss-Schaap J, Algazi A, Mateus C, Boasberg P, Tumeh PC, Chmielowski B, Ebbinghaus SW, Li XN, Kang SP, Ribas A: Safety and tumor responses with lambrolizumab (anti-PD-1) in melanoma. N Engl J Med. 2013 Jul 11;369(2):134-44. doi: 10.1056/NEJMoa1305133. Epub 2013 Jun 2. [PubMed:23724846]
  2. Boyerinas B, Jochems C, Fantini M, Heery CR, Gulley JL, Tsang KY, Schlom J: Antibody-Dependent Cellular Cytotoxicity Activity of a Novel Anti-PD-L1 Antibody Avelumab (MSB0010718C) on Human Tumor Cells. Cancer Immunol Res. 2015 Oct;3(10):1148-57. doi: 10.1158/2326-6066.CIR-15-0059. Epub 2015 May 26. [PubMed:26014098]
  3. Heery CR, O'Sullivan-Coyne G, Madan RA, Cordes L, Rajan A, Rauckhorst M, Lamping E, Oyelakin I, Marte JL, Lepone LM, Donahue RN, Grenga I, Cuillerot JM, Neuteboom B, Heydebreck AV, Chin K, Schlom J, Gulley JL: Avelumab for metastatic or locally advanced previously treated solid tumours (JAVELIN Solid Tumor): a phase 1a, multicohort, dose-escalation trial. Lancet Oncol. 2017 May;18(5):587-598. doi: 10.1016/S1470-2045(17)30239-5. Epub 2017 Mar 31. [PubMed:28373007]
  4. Kaufman HL, Russell J, Hamid O, Bhatia S, Terheyden P, D'Angelo SP, Shih KC, Lebbe C, Linette GP, Milella M, Brownell I, Lewis KD, Lorch JH, Chin K, Mahnke L, von Heydebreck A, Cuillerot JM, Nghiem P: Avelumab in patients with chemotherapy-refractory metastatic Merkel cell carcinoma: a multicentre, single-group, open-label, phase 2 trial. Lancet Oncol. 2016 Oct;17(10):1374-1385. doi: 10.1016/S1470-2045(16)30364-3. Epub 2016 Sep 1. [PubMed:27592805]
  5. Hamilton G, Rath B: Avelumab: combining immune checkpoint inhibition and antibody-dependent cytotoxicity. Expert Opin Biol Ther. 2017 Apr;17(4):515-523. doi: 10.1080/14712598.2017.1294156. Epub 2017 Feb 22. [PubMed:28274143]
  6. Apolo AB, Infante JR, Balmanoukian A, Patel MR, Wang D, Kelly K, Mega AE, Britten CD, Ravaud A, Mita AC, Safran H, Stinchcombe TE, Srdanov M, Gelb AB, Schlichting M, Chin K, Gulley JL: Avelumab, an Anti-Programmed Death-Ligand 1 Antibody, In Patients With Refractory Metastatic Urothelial Carcinoma: Results From a Multicenter, Phase Ib Study. J Clin Oncol. 2017 Apr 4:JCO2016716795. doi: 10.1200/JCO.2016.71.6795. [PubMed:28375787]
  7. Tan S, Zhang H, Chai Y, Song H, Tong Z, Wang Q, Qi J, Wong G, Zhu X, Liu WJ, Gao S, Wang Z, Shi Y, Yang F, Gao GF, Yan J: An unexpected N-terminal loop in PD-1 dominates binding by nivolumab. Nat Commun. 2017 Feb 6;8:14369. doi: 10.1038/ncomms14369. [PubMed:28165004]
  8. Merck-Pfizer Alliance: Avelumab Fact Sheet [Link]
  9. IMGT/mAb-DB card: Avelumab [Link]
External Links
PubChem Substance
347911260
Wikipedia
Avelumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (489 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0RecruitingTreatmentLymphomas non-Hodgkin's B-cell1
0RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
1Active Not RecruitingTreatmentLymphoma, Hodgkins1
1Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentTumors, Solid2
1Not Yet RecruitingTreatmentFollicular Lymphoma (FL)1
1Not Yet RecruitingTreatmentGBM / Glioblastomas1
1Not Yet RecruitingTreatmentLeptomeningeal Disease / Leptomeningeal Metastases1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingDiagnosticLung Cancer Non-Small Cell Cancer (NSCLC)1
1RecruitingTreatmentAdenocarcinomas1
1RecruitingTreatmentAdvanced Solid Tumors1
1RecruitingTreatmentCCND1 Positive / CD20 Positive / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Mantle Cell Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Mantle Cell Lymphoma / Transformed Follicular Lymphoma to Diffuse Large B-Cell Lymphoma1
1RecruitingTreatmentCancer of the Ovary / Tumors, Solid1
1RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck1
1RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1RecruitingTreatmentHepatocellular,Carcinoma1
1RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms1
1RecruitingTreatmentMeningioma, Adult / Meningiomas1
1RecruitingTreatmentMetastases to soft tissue / Tumors, Solid1
1RecruitingTreatmentMetastatic Solid Tumors1
1RecruitingTreatmentMetastatic Urothelial Cell Cancer1
1RecruitingTreatmentOncology / Tumors, Solid1
1RecruitingTreatmentRenal Cell Adenocarcinoma1
1RecruitingTreatmentTransitional Cell Carcinoma1
1, 2Active Not RecruitingTreatmentMalignant Neoplasm of Pancreas2
1, 2Active Not RecruitingTreatmentMerkel Cell Polyomavirus Infection / Stage IV Merkel Cell Carcinoma / Stage IV Merkel Cell Carcinoma AJCC v71
1, 2CompletedTreatmentFallopian Tube Cancer / Malignant Peritoneal Neoplasm / Ovarian Epithelial Cancer1
1, 2Not Yet RecruitingTreatmentCancer of the Ovary1
1, 2Not Yet RecruitingTreatmentChordomas / Unresectable Malignant Neoplasm1
1, 2Not Yet RecruitingTreatmentColorectal Cancers1
1, 2Not Yet RecruitingTreatmentGlioblastomas / Gliomas1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Not Yet RecruitingTreatmentMelanoma1
1, 2Not Yet RecruitingTreatmentNeuroendocrine Carcinoma of the Skin1
1, 2Not Yet RecruitingTreatmentNon Hodgkin Lymphoma (NHL)1
1, 2Not Yet RecruitingTreatmentOther Skin Disorders1
1, 2Not Yet RecruitingTreatmentTransitional Cell Carcinoma1
1, 2Not Yet RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentAcute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute, recurrent Myeloid Leukemia / Leukemia Acute Myeloid Leukemia (AML) / Refractory Acute Myeloid Leukemia / Relapsed Acute Myeloid Leukemia1
1, 2RecruitingTreatmentBladder Cancers / Invasive Bladder Cancer / Metastatic Bladder Cancer1
1, 2RecruitingTreatmentCarcinoma, Colorectal1
1, 2RecruitingTreatmentCastration-Resistant Prostate Cancer (CRPC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Breast Cancer (MBC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Urothelial carcinoma (UC)1
1, 2RecruitingTreatmentEarly Stage Non-small Cell Lung Cancer1
1, 2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / HPV Positive Oropharyngeal Squamous Cell Carcinoma / HPV-Related Carcinoma1
1, 2RecruitingTreatmentHepatocellular Carcinoma Non-resectable / Recurrent Hepatocellular Carcinoma1
1, 2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Minimal Residual Disease1
1, 2RecruitingTreatmentLeukemia, Myeloid, Chronic-Phase1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2RecruitingTreatmentMalignant Lymphomas / Refractory or Relapsed Solid Tumors1
1, 2RecruitingTreatmentMalignant Mesothelioma (MPM)1
1, 2RecruitingTreatmentMalignant Neoplasm of Breast / Malignant Neoplasms of Bone and Articular Cartilage / Malignant Neoplasms of Digestive Organs / Malignant Neoplasms of Eye Brain and Other Parts of Central Nervous System / Malignant Neoplasms of Female Genital Organs / Malignant Neoplasms of Ill-defined Secondary and Unspecified Sites / Malignant Neoplasms of Independent (Primary) Multiple Sites / Malignant Neoplasms of Lip Oral Cavity and Pharynx / Malignant Neoplasms of Male Genital Organs / Malignant Neoplasms of Mesothelial and Soft Tissue / Malignant Neoplasms of Respiratory and Intrathoracic Organs / Malignant Neoplasms of Thyroid and Other Endocrine Glands / Malignant Neoplasms of Urinary Tract / Neoplasms of Uncertain or Unknown Behavior1
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas2
1, 2RecruitingTreatmentMalignant Solid Tumours1
1, 2RecruitingTreatmentMCRC / Metastatic Colorectal Cancers1
1, 2RecruitingTreatmentMetastatic Leiomyosarcoma / Metastatic Liposarcoma / Unresectable Leiomyosarcoma / Unresectable Liposarcoma1
1, 2RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Non-Small Cell Lung Cancer Stage IIIB1
1, 2RecruitingTreatmentNeuroendocrine Carcinomas1
1, 2RecruitingTreatmentRecurrent Glioblastoma1
1, 2RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
1, 2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Clear-cell Kidney Carcinoma / RCC / Renal Cancers1
2Active Not RecruitingTreatmentHuman Papilloma Virus (HPV) / Juvenile Laryngeal Papilloma / Laryngeal Papilloma, Recurrent / Recurrent Respiratory Papillomatosis / Respiratory Papillomatosis1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2Active Not RecruitingTreatmentMalignant Neoplasm of Nasopharynx1
2Active Not RecruitingTreatmentMetastatic Colorectal Cancers1
2Active Not RecruitingTreatmentMicrosatellite Stable Relapsed or Refractory Colorectal Cancer1
2Active Not RecruitingTreatmentNeuroendocrine Carcinoma of the Skin1
2Enrolling by InvitationTreatmentLymphoma, Extranodal NK-T-Cell1
2Not Yet RecruitingTreatmentBladder Cancers / Muscle Invasive Bladder Cancer1
2Not Yet RecruitingTreatmentCancer of the Ovary1
2Not Yet RecruitingTreatmentColorectal Neoplasms, Malignant1
2Not Yet RecruitingTreatmentEndometrial Cancers1
2Not Yet RecruitingTreatmentInfiltrating Bladder Urothelial Carcinoma Sarcomatoid Variant / Infiltrating Bladder Urothelial Carcinoma With Glandular Differentiation / Infiltrating Bladder Urothelial Carcinoma With Squamous Differentiation / Infiltrating Bladder Urothelial Carcinoma, Micropapillary Variant / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / MTAP Negative / Urothelial carcinoma ureter metastatic1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2Not Yet RecruitingTreatmentLymphoma, Hodgkins1
2Not Yet RecruitingTreatmentMetastatic Angiosarcoma1
2Not Yet RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer1
2Not Yet RecruitingTreatmentMetastatic Leiomyosarcoma1
2Not Yet RecruitingTreatmentPancreatic Cancer Metastatic1
2Not Yet RecruitingTreatmentRectal Carcinoma1
2Not Yet RecruitingTreatmentSmall Cell Lung Carcinoma1
2Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Skin1
2Not Yet RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentAdenocarcinoma Of Esophagus / Gastric Adenocarcinoma1
2RecruitingTreatmentAntineoplastic Agents / Gonadal Disorders / Molecular Mechanisms of Pharmacological Action / Neoplasms / Neoplasms, Germ Cell and Embryonal / Testicular Diseases / Testicular Neoplasms1
2RecruitingTreatmentBladder Carcinoma1
2RecruitingTreatmentCancer That is Associated With a Chronic Viral Infection / EBER Positive Hodgkins and Non-hodgkins Lymphona / EBER Positive NPC / P16 Positive SCCHN / P16 Positive Squamous Cell Carcinoma of the Anus or Anal Canal / P16 Positive Squamous Cell Carcinoma of the Penis / P16 Positive Squamous Cell Carcinoma of the Vagina or Vulva / Squamous Cell Carcinoma of the Cervix1
2RecruitingTreatmentCancer, Advanced1
2RecruitingTreatmentCancer, Advanced / Metastatic Cancers / Penile Cancer1
2RecruitingTreatmentCancer, Breast2
2RecruitingTreatmentCarcinoma, Colorectal / Colorectal Adenocarcinoma / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
2RecruitingTreatmentEBV Positive Mutation Tumor / MSI-H Mutation Tumor / PD-L1 Positive Mutation Tumor / POLE/POLD1 Mutation Tumor1
2RecruitingTreatmentFallopian Tube Cancer / Primary Peritoneal Carcinoma / Recurrent Epithelial Cancer of Ovary / Recurrent Ovarian, Peritoneal and Fallopian Tube Cancer (ROPT)1
2RecruitingTreatmentGenes, BRCA 1 / Locally Advanced or Metastatic Solid Tumors1
2RecruitingTreatmentGestational Trophoblastic Neoplasias (GTN)1
2RecruitingTreatmentGlioblastoma Multiforme of Brain1
2RecruitingTreatmentGlioblastomas1
2RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma (SCC)1
2RecruitingTreatmentHepatocellular,Carcinoma1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Malignancies / Malignant Neoplasm of Pancreas1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Urothelial Cancer1
2RecruitingTreatmentMetastatic Colorectal Cancers / MSI1
2RecruitingTreatmentMalignancies1
2RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2RecruitingTreatmentMetastatic Colorectal Cancers1
2RecruitingTreatmentMetastatic Urothelial Cancer1
2RecruitingTreatmentNeuroendocrine Carcinoma, Grade 31
2RecruitingTreatmentNeuroendocrine Tumors1
2RecruitingTreatmentNon-metastatic Muscle Invasive Bladder Cancer1
2RecruitingTreatmentPancreatic Cancer Resectable / Pancreatic Cancer, Resectable Adenocarcinoma of the Pancreas1
2RecruitingTreatmentProstate Cancer1
2RecruitingTreatmentRecurrent Glioblastoma (WHO-Grade IV Glioma)1
2RecruitingTreatmentRecurrent Cutaneous T-cell lymphoma / Refractory T-Cell Lymphoma1
2RecruitingTreatmentRenal Cell Adenocarcinoma1
2RecruitingTreatmentSarcoma, Osteogenic1
2RecruitingTreatmentSquamous Non-Small Cell Lung Cancer1
2RecruitingTreatmentAdvanced thymic carcinoma / Thymic Carcinoma1
2RecruitingTreatmentMetastatic Endometrial cancer1
2SuspendedTreatmentBladder Carcinoma Infiltrating the Muscle of the Bladder Wall / Stage II Bladder Cancer AJCC v8 / Stage II Renal Pelvis Cancer AJCC v8 / Stage II Ureter Cancer AJCC v8 / Stage II Urethral Cancer AJCC v8 / Stage III Bladder Cancer AJCC v8 / Stage III Renal Pelvis Cancer AJCC v8 / Stage III Ureter Cancer AJCC v8 / Stage III Urethral Cancer AJCC v8 / Stage IIIA Bladder Cancer AJCC v8 / Stage IIIB Bladder Cancer AJCC v8 / Urethral Urothelial Carcinoma1
3Active Not RecruitingTreatmentCancer of the Ovary2
3Active Not RecruitingTreatmentFirst Line Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentGastric Cancer Third Line / Unresectable, Recurrent, Locally Advanced or Metastatic Gastric or Gastroesophageal Junction Adenocarcinoma1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3Active Not RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
3Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentUnresectable, Locally Advanced or Metastatic, Adenocarcinoma of the Stomach, or of the Gastro Esophageal Junction1
3RecruitingTreatmentCancer of the Ovary1
3RecruitingTreatmentHNSCC1
3RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
3RecruitingTreatmentStage III Merkel Cell Carcinoma / Stage III Merkel Cell Carcinoma AJCC v7 / Stage IIIB Merkel Cell Carcinoma / Stage IIIB Merkel Cell Carcinoma AJCC v71
3RecruitingTreatmentTriple Negative Breast Neoplasms1
3RecruitingTreatmentUrothelial Cancer1
Not AvailableAvailableNot AvailableMetastatic Merkel Cell Carcinoma1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solution, concentrateIntravenous20 mg/1mL
SolutionIntravenous20 mg
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Not Available
Specific Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell ...
Gene Name
CD274
Uniprot ID
Q9NZQ7
Uniprot Name
Programmed cell death 1 ligand 1
Molecular Weight
33275.095 Da
References
  1. Hamid O, Robert C, Daud A, Hodi FS, Hwu WJ, Kefford R, Wolchok JD, Hersey P, Joseph RW, Weber JS, Dronca R, Gangadhar TC, Patnaik A, Zarour H, Joshua AM, Gergich K, Elassaiss-Schaap J, Algazi A, Mateus C, Boasberg P, Tumeh PC, Chmielowski B, Ebbinghaus SW, Li XN, Kang SP, Ribas A: Safety and tumor responses with lambrolizumab (anti-PD-1) in melanoma. N Engl J Med. 2013 Jul 11;369(2):134-44. doi: 10.1056/NEJMoa1305133. Epub 2013 Jun 2. [PubMed:23724846]

Drug created on October 20, 2016 15:03 / Updated on December 14, 2018 05:46