This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification
NameZalutumumab
Accession NumberDB12202  (DB05324)
TypeBiotech
GroupsInvestigational
Description

Zalutumumab (proposed trade name HuMax-EGFR) is a fully human IgG1 monoclonal antibody (mAb) directed towards the epidermal growth factor receptor (EGFR). Zalutumumab has been investigated for the treatment of Squamous Cell Cancer and Head and Neck Cancer.

Protein structureNo structure small
Related Articles
Protein chemical formulaC6512H10074N1734O2032S46
Protein average weight146641.0546 Da
Sequences
> Zalutumumab (A chain)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYGMHWVRQAPGKGLEWVAVIWDDGSYKYY
GDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGITMVRGVMKDYFDYWGQGTL
VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAP
ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP
PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV
DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
> Zalutumumab (B chain)
AIQLTQSPSSLSASVGDRVTITCRASQDISSALVWYQQKPGKAPKLLIYDASSLESGVPS
RFSGSESGTDFTLTISSLQPEDFATYYCQQFNSYPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
SynonymsNot Available
External IDs 2F8
Product Ingredients Not Available
ProductsNot Available
International Brands
NameCompany
HuMax-EGFRNot Available
HuMax-EGFR-2F8Not Available
HuMax-EGFR, 2F8Not Available
Brand mixturesNot Available
CategoriesNot Available
UNIIDA709Q5020
CAS number667901-13-5
Pharmacology
IndicationNot Available
Structured Indications Not Available
PharmacodynamicsNot Available
Mechanism of action
TargetKindPharmacological actionActionsOrganismUniProt ID
Epidermal growth factor receptorProteinyes
antagonist
HumanP00533 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organismsNot Available
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Zalutumumab.Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Zalutumumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Zalutumumab.Investigational
RindopepimutThe therapeutic efficacy of CDX-110 can be decreased when used in combination with Zalutumumab.Investigational
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Zalutumumab.Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Bastholt L, Specht L, Jensen K, Brun E, Loft A, Petersen J, Kastberg H, Eriksen JG: Phase I/II clinical and pharmacokinetic study evaluating a fully human monoclonal antibody against EGFr (HuMax-EGFr) in patients with advanced squamous cell carcinoma of the head and neck. Radiother Oncol. 2007 Oct;85(1):24-8. Epub 2007 Jun 28. [PubMed:17602769 ]
External Links
ATC CodesNot Available
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelNot Available
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
1, 2CompletedTreatmentHead and Neck Carcinoma1
1, 2CompletedTreatmentNeoplasms, Head and Neck1
1, 2TerminatedTreatmentColorectal Cancers1
1, 2TerminatedTreatmentHead and Neck Carcinoma / Squamous Cell Cancer1
1, 2TerminatedTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma (SCC)1
2CompletedNot AvailableHead and Neck Carcinoma / Squamous Cell Cancer1
2TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2WithdrawnTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
3CompletedTreatmentCancers of the Head and Neck1
3CompletedTreatmentHead and Neck Carcinoma / Squamous Cell Cancer1
Properties
StateLiquid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonist
General Function:
Ubiquitin protein ligase binding
Specific Function:
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on ke...
Gene Name:
EGFR
Uniprot ID:
P00533
Molecular Weight:
134276.185 Da
References
  1. Bleeker WK, Lammerts van Bueren JJ, van Ojik HH, Gerritsen AF, Pluyter M, Houtkamp M, Halk E, Goldstein J, Schuurman J, van Dijk MA, van de Winkel JG, Parren PW: Dual mode of action of a human anti-epidermal growth factor receptor monoclonal antibody for cancer therapy. J Immunol. 2004 Oct 1;173(7):4699-707. [PubMed:15383606 ]
Drug created on October 20, 2016 15:36 / Updated on June 07, 2017 15:23