Pancrelipase lipase

Identification

Name
Pancrelipase lipase
Accession Number
DB13147
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

Pancrelipase, in general, is composed of a mixture of pancreatic enzymes which include amylases, lipases, and proteases. These enzymes are extracted from porcine pancreatic glands.3 The pancrelipase lipase is an enzyme secreted by the pancreas that is responsible for the hydrolysis of dietary fat molecules in the human digestive system.1 The pancrelipase mixture, including pancrelipase lipase, was developed by Ortho-McNeil-Janssen Pharmaceuticals, Inc and FDA approved on April 12, 2010.4

Protein structure
Db13147
Protein chemical formula
Not Available
Protein average weight
48000.0 Da
Sequences
>sp|P00591|LIPP_PIG Pancreatic triacylglycerol lipase OS=Sus scrofa OX=9823 GN=PNLIP PE=1 SV=2
SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTI
TNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQ
NIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAE
PCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQK
NILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPC
PSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSL
FGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNNNVINPTLPRVGASK
ITVERNDGKVYDFCSQETVREEVLLTLNPC
>sp|P02703|COL_PIG Colipase OS=Sus scrofa OX=9823 GN=CLPS PE=1 SV=3
MEKVLALLLVTLTVAYAVPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKA
RENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHDVGRSSD
Download FASTA Format
Synonyms
  • Lipase, pancreatic
  • Pancreatic lipase
Product Images
Over the Counter Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Formula C & ETabletOralAbundance Naturally Ltd1998-01-052006-06-16Canada
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
CotazymPancrelipase lipase (10000 units) + Pancrelipase amylase (40000 units) + Pancrelipase protease (35000 units)CapsuleOralMerck Ltd.1973-12-31Not applicableCanada
Cotazym Ecs 20Pancrelipase lipase (25000 units) + Pancrelipase amylase (100000 units) + Pancrelipase protease (100000 units)Capsule, delayed releaseOralMerck Ltd.1989-12-31Not applicableCanada
Cotazym Ecs 4Pancrelipase lipase (4000 unit) + Pancrelipase amylase (11000 unit) + Pancrelipase protease (11000 unit)CapsuleOralMerck Ltd.1997-08-182012-01-23Canada
Cotazym Ecs 8Pancrelipase lipase (10800 units) + Pancrelipase amylase (42000 units) + Pancrelipase protease (45000 units)Capsule, delayed releaseOralMerck Ltd.1980-12-31Not applicableCanada
CreonPancrelipase lipase (12000 [USP'U]/1) + Pancrelipase amylase (60000 [USP'U]/1) + Pancrelipase protease (38000 [USP'U]/1)Capsule, delayed release pelletsOralAtlantic Biologicals Corps.2010-08-13Not applicableUs17856 121220171018 3478 1444e92
CreonPancrelipase lipase (6000 [USP'U]/1) + Pancrelipase amylase (30000 [USP'U]/1) + Pancrelipase protease (19000 [USP'U]/1)Capsule, delayed release pelletsOralAtlantic Biologicals Corps.2010-08-13Not applicableUs17856 120620171018 3478 1x59skm
CreonPancrelipase lipase (36000 [USP'U]/1) + Pancrelipase amylase (180000 [USP'U]/1) + Pancrelipase protease (114000 [USP'U]/1)Capsule, delayed release pelletsOralAbbVie Inc.2013-03-14Not applicableUs0032 301620171018 3478 1xzy1f3
CreonPancrelipase lipase (3000 [USP'U]/1) + Pancrelipase amylase (15000 [USP'U]/1) + Pancrelipase protease (9500 [USP'U]/1)Capsule, delayed releaseOralAbbVie Inc.2009-04-30Not applicableUs
CreonPancrelipase lipase (24000 [USP'U]/1) + Pancrelipase amylase (120000 [USP'U]/1) + Pancrelipase protease (76000 [USP'U]/1)Capsule, delayed release pelletsOralAbbVie Inc.2009-04-30Not applicableUs0032 122420171018 3478 3zx10l
CreonPancrelipase lipase (24000 [USP'U]/1) + Pancrelipase amylase (120000 [USP'U]/1) + Pancrelipase protease (76000 [USP'U]/1)Capsule, delayed release pelletsOralAtlantic Biologicals Corps.2010-08-13Not applicableUs17856 122420171018 3478 17bvxdq
Unapproved/Other Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Creon 10 MinimicrospheresPancrelipase lipase (10000 [USP'U]/1) + Pancrelipase amylase (33200 [USP'U]/1) + Pancrelipase protease (37500 [USP'U]/1)Capsule, delayed releaseOralPhysicians Total Care, Inc.2006-09-122009-09-30Us
Creon 20 MinimicrospheresPancrelipase lipase (20000 [USP'U]/1) + Pancrelipase amylase (66400 [USP'U]/1) + Pancrelipase protease (75000 [USP'U]/1)Capsule, delayed releaseOralPhysicians Total Care, Inc.1995-01-172009-09-30Us
PancrelipasePancrelipase lipase (20000 [USP'U]/1) + Pancrelipase amylase (56000 [USP'U]/1) + Pancrelipase protease (44000 [USP'U]/1)Capsule, delayed releaseOralKaiser Foundations Hospitals2010-02-012010-12-31Us
Categories
UNII
8MYC33932O
CAS number
9001-62-1

Pharmacology

Indication

Please refer to Pancrelipase.

Pharmacodynamics

Please refer to Pancrelipase.

Mechanism of action

Pancrelipase lipase catalyzes the hydrolysis of triglycerides to monoglycerides, glycerol, and fatty acids. This activity is performed by the hydrolyzation of the esters of fatty acids. The hydrolysis is started by the action of colipase which helps to anchor lipase to the lipid-water membrane of the micelle producing a surface change on lipase. The hydrophobic active site is exposed for the binding of triglycerides and further interaction with the catalytic triad. In this triad, the function of the three amino acids allows the formation of a deprotonated serine which becomes a nucleophile and act on the ester carbonyl of the fatty acids for the later formation of monoglyceride and fatty acid monomers.2

TargetActionsOrganism
ADietary fat
cleavage
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Please refer to Pancrelipase.

Volume of distribution

Please refer to Pancrelipase.

Protein binding

Please refer to Pancrelipase.

Metabolism

Please refer to Pancrelipase.

Route of elimination

Please refer to Pancrelipase.

Half life

Please refer to Pancrelipase.

Clearance

Please refer to Pancrelipase.

Toxicity

Please refer to Pancrelipase.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions
Not Available

References

General References
  1. Chapus C, Rovery M, Sarda L, Verger R: Minireview on pancreatic lipase and colipase. Biochimie. 1988 Sep;70(9):1223-34. [PubMed:3147715]
  2. Chapus C, Semeriva M, Bovier-Lapierre C, Desnuelle P: Mechanism of pancreatic lipase action. 1. Interfacial activation of pancreatic lipase. Biochemistry. 1976 Nov 16;15(23):4980-7. [PubMed:990257]
  3. Creon monograph [Link]
  4. FDA approval [Link]
External Links
PubChem Substance
347911431
RxNav
1427018
Wikipedia
Pancreatic_lipase_family
AHFS Codes
  • 56:16.00 — Digestants
FDA label
Download (483 KB)
MSDS
Download (62.3 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1TerminatedTreatmentHypoglycemia1
1TerminatedTreatmentPancreatitis, Chronic1
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas / Pancreatic enzyme abnormality / Pancreatic Insufficiency1
2CompletedNot AvailableExocrine Pancreatic Insufficiency in Subjects With Cystic Fibrosis1
2CompletedDiagnosticPancreatitis, Chronic1
2CompletedTreatmentShort bowel condition / Short Bowel Syndrome (SBS)1
2TerminatedSupportive CareMalignant Neoplasm of Pancreas1
2TerminatedTreatmentPancreatic Exocrine Insufficiency Due to Chronic Pancreatitis1
3CompletedTreatmentCystic Fibrosis (CF) / Exocrine Pancreatic Insufficiency1
3CompletedTreatmentExocrine Pancreatic Insufficiency: Cystic Fibrosis1
3CompletedTreatmentExocrine Pancreatic Insufficiency / Pancreatitis, Chronic1
3CompletedTreatmentPancreatic Exocrine Insufficiency1
3CompletedTreatmentPancreatic Exocrine Insufficiency Due to Cystic Fibrosis1
3CompletedTreatmentPostprandial Belching / Postprandial Bloating / Postprandial Eructation1
3RecruitingTreatmentPancreatic Insufficiency1
3TerminatedTreatmentPrevention of Growth Restriction1
3TerminatedTreatmentFat malabsorption1
4CompletedNot AvailableBMI >30 kg/m21
4CompletedTreatmentCystic Fibrosis (CF) / Exocrine Pancreatic Insufficiency2
4CompletedTreatmentExocrine Pancreatic Insufficiency / Pancreatitis, Chronic1
4CompletedTreatmentPancreatic Insufficiency1
4CompletedTreatmentPancreatitis, Chronic1
4Not Yet RecruitingTreatmentExocrine Pancreatic Insufficiency (EPI)1
4RecruitingTreatmentCystic Fibrosis (CF)1
4RecruitingTreatmentExocrine Pancreatic Insufficiency (EPI)1
4TerminatedTreatmentPatients With Coeliac Disease and Chronic Diarrhoea (>3 Loose/ Liquid Motions a Day for More Than 4 Weeks) / Patients With Pancreatic Exocrine Insufficiency1
4WithdrawnTreatmentExocrine Pancreatic Insufficiency in Subjects With Diabetes Mellitus Type 21
Not AvailableCompletedBasic SciencePancreatitis1
Not AvailableCompletedTreatmentBMI >30 kg/m21
Not AvailableCompletedTreatmentCystic Fibrosis (CF)1
Not AvailableNo Longer AvailableNot AvailableLysosomal Acid Lipase Deficiency1
Not AvailableNot Yet RecruitingNot AvailableAdenocarcinoma of the Pancreas1
Not AvailableNot Yet RecruitingNot AvailablePancreatic Fistula1
Not AvailableRecruitingNot AvailableFibrosing colonopathy / Fibrosing Colonopathy in Patients With Cystic Fibrosis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Capsule, delayed release pelletsOral
Capsule, delayed releaseOral
Granule, delayed releaseOral
CapsuleOral
TabletOral
Capsule, extended releaseOral
TabletOral
PowderOral
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US9198871No2015-12-012030-02-07Us
US8562979No2013-10-222028-02-20Us
US8562980No2013-10-222028-02-20Us
US8562981No2013-10-222028-02-20Us
US8221747No2012-07-172028-02-20Us
US8562978No2013-10-222028-02-20Us
US8246950No2012-08-212028-02-20Us
US7658918No2010-02-092028-02-20Us
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Solid
Experimental Properties
PropertyValueSource
water solubilitySlightly soluble 'MSDS'
isoelectric point7.4Iizuka K. et al. 1991. Ann clin Biochem.

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

1. Dietary fat
Kind
Group
Organism
Humans
Pharmacological action
Yes
Actions
Cleavage
References
  1. Chapus C, Semeriva M, Bovier-Lapierre C, Desnuelle P: Mechanism of pancreatic lipase action. 1. Interfacial activation of pancreatic lipase. Biochemistry. 1976 Nov 16;15(23):4980-7. [PubMed:990257]

Drug created on November 16, 2016 08:28 / Updated on July 12, 2020 18:27

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates