1,3-beta-glucan synthase component FKS1

Details

Name
1,3-beta-glucan synthase component FKS1
Synonyms
  • 1,3-beta-D-glucan-UDP glucosyltransferase
  • 2.4.1.34
  • fks1
Gene Name
fksA
Organism
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Amino acid sequence
>lcl|BSEQ0013251|1,3-beta-glucan synthase component FKS1
MSGYPAGHYEDGYGHQEHGGDAYYQDEHGQAYYDPNDYGDSYYDRGNYYNAEGGQAYGQE
GGYYDAGHQDDYYGDQYYDQGNGAPRGRRRGDSEEDSETFSDFTMRSETARAADMDYYGR
GDERYNSYADSQYAGRGYNGYRPPSSQVSYGANRSSGASTPVYGMDYGSALPGGPRSREP
YPAWASDGQVPVSKEEIEDIFIDLVNKFGFQRDSMRNMYDHLMTQLDSRASRMTPNQALL
SLHADYIGGDNANYRRWYFAAHLDLDDAVGFANMKLGKADRKTRKARKAAKAAAQQNPEN
VEENLEAMEGDNSLEAAVYRWKSRMNRMSPHDRVRQLALYMLCWGEANQVRYMPECICFI
FKCADDYYSSPECQSRVEPVEEFTYLNEIITPLYQFCRDQGYEILDGKYVRRERDHEKII
GYDDMNQLFWYPEGIERISFEDKTRLVDVPPAERWTKLKDVDWKKAFFKTYRETRSWFHM
ITNFNRIWVIHLGAFWFFTAYNAPTLYTKNYQQQLDNKPAGSKYWSAVGFGGALVGLIQI
LATLCEWMYVPRRWAGAQHLSKRLMFLIAVFIVNLAPGVVVFGFNNVLSETICLIIGIVH
FFIALATFFFFSVMPLGGLFGSYLKKHGRQYVASQTFTASYPRLNGNDMWMSYGLWICVF
GAKLVESYFFLTLSLKDPMRILSPMRIHQCAGVTYIPNSLCHAQPQILLGLMMFMDLTLF
FLDSYLWYVICNTIFSVARSFYLGVSIWSPWRNIFSRLPKRIYSKVLATTDMEIKYKPKV
LISQVWNAIIISMYREHLLAIDHVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDQSFKTEF
FPAGSEAERRISFFAQSVATPMPEPLPVDNMPTFTVLIPHYGEKILLSLREIIREDEPYS
RVTLLEYLKQLHPHEWDCFVKDTKILADETSQLNGEPEKNEKDAQKSKIDDLPFYCIGFK
SAAPEYTLRTRIWSSLRSQTLYRTISGFMNYSRAIKLLYRVENPEVVQMFGGNSEKLERE
LERMARRKFKICVSMQRYAKFNKEERENTEFLLRAYPDLQIAYLDEEPPANEGEEPRLYS
ALIDGHCELLDNGMRKPKFRIQLSGNPILGDGKSDNQNHSIIFYRGEYIQVIDANQDNYL
EECLKIRSVLAEFEELTTDNVSPYTPGIATEAETPVAILGAREYIFSENVGVLGDVAASK
EQTFGTLFARTLAQIGGKLHYGHPDFLNGIFMTTRGGISKAQKGLHLNEDIYAGMTALCR
GGRIKHCEYFQCGKGRDLGFGSILNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFLSFYY
AHPGFHLNNMFIMLSVQMFMIVLINLGALKHETITCRYNSNLPITDPLRPTYCADLTPII
AWVNRCVVSIFIVFFISFVPLAVQELTERGLWRMATRLAKHFGSFSFMFEVFVCQIYANA
VHQNLSFGGARYIGTGRGFATARIPFGVLYSRFAGPSIYAGSRLLLMLLFATSTVWTPAL
IWFWVSLLALCISPFLFNPHQFAWHDFFIDYRDYIRWLSRGNSRSHASSWIAFCRLSRTR
LTGYKRKLLGVPSEKGSGDVPRAKFTNIFFSEIIAPLVQVAVTLVPYLYINSRTGISNDN
ERASNAVVRIAIVAFGPIGVNAGVSGMFFGMACCMGPIFGMCCKKFGAVLAAIAHAIAVI
ILLVIFEVMFFLESWSWPRMVLGMISAAAIQRFIYKLIISLALTREFKHDQSNIAWWTGK
WYNMGWHSLSQPGREFLCKITELGYFSADFVLGHILLFVMLPALCIPYVDKFHSVILFWL
RPSRQIRPPIYSLKQSKLRKRRVVRFAILYFTMLVLFLILLIAPLVARDEGISVNLNIMS
LMQPLDTDNNDTISSYTGNGLPVGYSAWTPSAASASA
Number of residues
1897
Molecular Weight
216972.8
Theoretical pI
Not Available
GO Classification
Functions
1,3-beta-D-glucan synthase activity
Processes
(1->3)-beta-D-glucan biosynthetic process / cell wall organization / regulation of cell shape
Components
1,3-beta-D-glucan synthase complex / integral component of membrane / mitochondrion
General Function
1,3-beta-d-glucan synthase activity
Specific Function
Catalytic subunit of the 1,3-beta-glucan synthase. Synthesizes 1,3-beta-glucan, a major structural component of the cell wall. Involved in cell wall synthesis, maintenance and cell wall remodeling (By similarity).
Pfam Domain Function
Transmembrane Regions
487-507 525-545 564-584 591-611 655-675 707-727 728-748 1329-1349 1386-1406 1473-1493 1497-1517 1588-1608 1630-1650 1666-1686 1701-1721 1766-1786 1826-1846
Cellular Location
Mitochondrion
Gene sequence
>lcl|BSEQ0013252|1,3-beta-glucan synthase component FKS1 (fksA)
ATGTCAGGCTATCCAGCAGGGCATTACGAGGATGGCTACGGCCACCAGGAGCATGGGGGC
GATGCGTACTACCAGGACGAACATGGCCAGGCTTATTACGATCCTAACGATTACGGTGAC
AGCTATTATGATAGAGGCAATTATTACAACGCAGAAGGAGGTCAGGCATATGGCCAAGAA
GGTGGTTACTACGATGCTGGTCACCAGGATGACTACTACGGTGACCAGTACTATGACCAA
GGAAATGGTGCCCCCCGCGGAAGACGCCGTGGAGATTCTGAGGAGGATTCGGAGACCTTT
AGCGATTTCACCATGAGGTCAGAGACTGCTCGAGCTGCGGATATGGATTACTATGGCCGT
GGAGACGAACGTTACAACAGTTATGCCGACAGCCAGTATGCTGGTCGTGGATACAACGGA
TACCGGCCGCCATCTTCGCAGGTCTCGTATGGCGCCAACCGATCATCTGGCGCTTCGACA
CCCGTATACGGCATGGACTACGGAAGCGCCCTTCCTGGTGGACCGCGTTCTCGGGAGCCG
TACCCAGCCTGGGCATCGGATGGTCAGGTCCCTGTCTCCAAGGAGGAAATCGAAGATATC
TTCATTGACTTGGTCAACAAATTCGGTTTCCAGAGGGACAGCATGCGCAACATGTATGAC
CACCTGATGACACAGTTGGACTCCCGGGCCTCCAGAATGACGCCCAACCAAGCCCTTCTG
TCTCTGCACGCAGACTACATTGGTGGTGACAATGCCAACTACCGCCGTTGGTATTTTGCT
GCCCATCTGGATTTGGACGATGCCGTGGGATTCGCCAACATGAAGCTGGGCAAAGCAGAC
CGGAAGACCAGGAAAGCTCGCAAAGCGGCCAAGGCGGCAGCACAGCAGAACCCTGAAAAC
GTCGAGGAGAACCTGGAGGCCATGGAAGGCGACAACAGCCTGGAAGCCGCTGTTTACAGG
TGGAAGAGCCGCATGAACCGCATGTCCCCGCATGATCGTGTGCGCCAATTGGCTCTGTAC
ATGCTGTGCTGGGGTGAAGCTAACCAGGTCCGGTACATGCCTGAGTGCATTTGCTTCATC
TTCAAGTGTGCGGATGATTACTACAGCTCCCCTGAATGCCAGAGCCGGGTTGAGCCGGTG
GAGGAATTCACTTACCTGAATGAGATCATTACCCCCCTCTATCAGTTCTGCCGTGACCAG
GGTTACGAAATCTTGGATGGCAAGTATGTTCGCCGCGAGCGTGATCACGAGAAGATCATC
GGATACGATGATATGAACCAGCTTTTCTGGTACCCCGAGGGTATCGAACGCATCTCATTC
GAGGATAAGACTCGTCTTGTCGATGTCCCCCCAGCTGAAAGATGGACCAAGTTGAAGGAC
GTCGACTGGAAGAAAGCATTCTTCAAGACGTACAGAGAGACTCGGTCCTGGTTCCACATG
ATCACCAACTTCAACCGTATCTGGGTTATTCACCTGGGTGCTTTCTGGTTCTTCACTGCT
TATAACGCCCCCACCTTGTATACCAAGAACTACCAGCAGCAGCTGGACAATAAGCCCGCT
GGTTCAAAGTATTGGTCTGCTGTCGGTTTTGGTGGTGCCCTGGTTGGATTAATTCAGATC
TTGGCAACGCTCTGTGAGTGGATGTACGTGCCTCGCCGGTGGGCAGGTGCTCAGCATCTC
AGCAAGCGTCTTATGTTCCTTATCGCCGTTTTCATTGTCAATCTTGCTCCTGGTGTCGTG
GTCTTCGGTTTCAACAATGTTCTCAGTGAGACAATCTGCCTCATCATTGGTATCGTCCAC
TTCTTCATTGCTCTGGCCACGTTCTTCTTTTTCTCCGTCATGCCTCTTGGAGGTCTGTTC
GGCAGTTACCTGAAGAAGCACGGCCGTCAATATGTGGCCAGTCAGACATTCACGGCGAGC
TACCCTCGCCTGAATGGCAACGACATGTGGATGTCTTATGGTCTGTGGATCTGTGTTTTC
GGTGCGAAGCTGGTCGAGTCTTACTTCTTCCTGACTCTGTCATTGAAGGATCCCATGCGT
ATCTTGTCGCCGATGCGTATCCATCAGTGTGCTGGTGTGACATACATCCCGAACAGCCTT
TGCCACGCCCAGCCTCAGATTCTGCTGGGTCTGATGATGTTCATGGATTTGACTCTTTTC
TTCCTGGATAGTTATCTGTGGTATGTCATTTGTAACACCATCTTCTCGGTGGCTCGGTCC
TTCTACCTGGGTGTCTCCATCTGGTCGCCCTGGAGAAACATCTTCTCTCGCCTACCGAAG
CGTATCTATTCGAAGGTCTTGGCTACGACCGACATGGAGATCAAGTACAAGCCCAAGGTG
CTCATTTCCCAAGTTTGGAACGCCATCATCATCTCCATGTACCGTGAGCATCTGCTGGCG
ATTGATCACGTCCAGAAGTTGCTTTACCACCAGGTTCCCTCCGAACAGGAGGGCAAGCGT
ACCCTGCGGGCTCCTACCTTCTTCGTTTCGCAGGAAGACCAGTCCTTCAAGACTGAGTTC
TTCCCCGCGGGTAGTGAGGCTGAGCGCCGTATCTCCTTCTTTGCCCAGTCGGTCGCTACC
CCCATGCCTGAGCCTCTTCCGGTTGACAACATGCCCACTTTCACTGTCCTTATCCCCCAT
TACGGAGAGAAGATTCTGCTGTCGTTGCGTGAAATCATTCGTGAGGATGAGCCGTACTCT
CGCGTTACTCTCCTGGAATACCTGAAACAGCTCCACCCCCACGAGTGGGACTGCTTCGTC
AAGGACACAAAGATTCTGGCTGATGAGACCTCACAACTCAACGGCGAACCCGAGAAGAAC
GAGAAGGATGCGCAGAAGAGCAAGATCGACGACCTTCCCTTCTATTGCATCGGTTTCAAG
TCTGCCGCTCCCGAATACACGCTCCGTACCCGTATCTGGTCCTCTCTGCGCTCTCAGACC
CTGTACAGAACCATTTCCGGTTTCATGAACTACAGCAGGGCCATCAAGCTCCTTTACCGT
GTCGAAAACCCCGAGGTCGTCCAGATGTTTGGTGGTAACTCCGAGAAGCTCGAACGTGAG
CTTGAAAGGATGGCGCGCCGCAAGTTCAAGATCTGTGTCTCAATGCAACGTTACGCCAAG
TTCAACAAGGAAGAGCGTGAAAACACCGAGTTCCTTCTCCGTGCCTACCCTGATCTCCAA
ATCGCTTACCTTGACGAGGAACCCCCTGCCAATGAGGGTGAGGAGCCCCGCTTGTACTCG
GCTTTGATTGATGGACACTGTGAGCTCCTCGACAACGGAATGCGCAAGCCGAAGTTCAGA
ATTCAGCTCTCCGGAAACCCTATCCTGGGTGACGGCAAGTCCGATAACCAGAACCACTCT
ATCATCTTCTACCGCGGTGAATACATCCAGGTCATTGACGCTAACCAGGATAACTACCTG
GAGGAGTGTCTCAAGATCCGTAGCGTTCTGGCTGAGTTCGAAGAACTTACCACCGACAAT
GTCTCGCCCTACACTCCTGGTATTGCCACCGAAGCTGAGACCCCAGTCGCCATTCTCGGT
GCTCGTGAATACATTTTCTCTGAGAATGTTGGTGTTCTTGGTGACGTTGCTGCCAGTAAG
GAACAGACGTTCGGTACCCTGTTTGCTCGTACCCTTGCGCAGATTGGTGGAAAGCTGCAT
TATGGTCACCCTGATTTCCTAAACGGTATCTTCATGACGACGCGTGGTGGTATCTCCAAG
GCTCAGAAGGGTCTCCACCTGAACGAGGATATTTATGCTGGTATGACTGCTTTGTGCCGT
GGTGGACGCATCAAGCATTGCGAGTACTTCCAGTGTGGTAAGGGTCGTGATTTGGGTTTC
GGCTCCATTCTGAACTTCACAACCAAGATTGGTACTGGTATGGGTGAGCAGATGCTGTCC
AGAGAGTACTACTATCTCGGAACACAGCTGCCCCTCGATCGCTTCCTGTCTTTCTACTAT
GCTCACCCTGGTTTCCATCTTAACAACATGTTCATTATGTTGTCTGTGCAGATGTTCATG
ATCGTTCTGATCAACCTTGGTGCTCTGAAGCATGAGACTATTACATGCCGTTACAACTCG
AACCTGCCCATTACTGACCCTCTGCGTCCCACGTACTGTGCTGATCTTACCCCCATTATC
GCCTGGGTGAACCGTTGCGTCGTTTCCATCTTCATTGTGTTCTTCATCTCCTTCGTTCCC
CTGGCCGTCCAGGAATTGACTGAGAGGGGTCTTTGGCGCATGGCTACTCGTCTGGCCAAG
CACTTTGGTTCCTTCTCCTTCATGTTCGAGGTGTTTGTCTGCCAAATCTACGCCAATGCT
GTTCACCAGAACCTTTCCTTCGGCGGTGCTCGCTACATCGGTACTGGACGTGGTTTCGCT
ACGGCTCGTATCCCATTCGGTGTCTTGTACTCCCGTTTCGCTGGACCATCCATCTATGCC
GGTTCTCGTTTGCTGCTCATGCTTCTGTTTGCGACATCCACTGTCTGGACACCAGCCCTG
ATCTGGTTCTGGGTTTCTCTGCTTGCTCTCTGCATTTCCCCCTTCCTGTTCAACCCCCAC
CAGTTTGCTTGGCACGATTTCTTTATCGACTACCGCGATTACATCAGATGGCTGTCCCGT
GGTAACTCTCGCTCGCACGCTTCGTCCTGGATCGCCTTCTGCCGCCTGTCTCGTACCCGT
CTCACTGGTTACAAGCGCAAGCTTCTTGGTGTTCCTTCGGAGAAGGGATCTGGCGATGTT
CCCAGGGCCAAGTTCACGAACATTTTCTTTAGTGAGATCATTGCCCCTCTCGTCCAAGTT
GCTGTGACTTTGGTTCCTTACCTCTACATCAACTCGAGAACTGGTATCTCCAATGACAAC
GAGCGGGCGTCAAATGCCGTGGTTCGTATTGCCATCGTCGCCTTCGGTCCCATCGGTGTT
AACGCCGGTGTCTCGGGTATGTTCTTCGGTATGGCTTGCTGTATGGGTCCCATCTTTGGC
ATGTGCTGCAAGAAGTTTGGTGCAGTCCTCGCTGCTATCGCTCACGCCATCGCGGTTATT
ATCCTGCTTGTCATTTTCGAGGTCATGTTCTTCCTTGAGAGCTGGTCCTGGCCTCGCATG
GTCCTGGGAATGATTTCTGCCGCTGCAATTCAGCGCTTCATCTACAAGCTGATCATCTCC
CTCGCCCTGACCAGAGAATTCAAGCATGACCAGTCGAACATCGCTTGGTGGACCGGAAAA
TGGTACAACATGGGTTGGCACTCGCTTTCCCAGCCTGGCAGAGAATTCCTGTGCAAGATT
ACCGAGCTTGGATACTTCTCTGCCGACTTTGTCCTGGGCCATATTCTCCTCTTTGTCATG
CTTCCTGCTCTCTGCATCCCCTATGTTGACAAGTTCCACTCCGTTATCCTCTTCTGGCTG
AGGCCTAGTCGTCAAATTCGCCCTCCCATCTACTCTCTGAAGCAGTCTAAGCTCCGCAAG
AGAAGAGTTGTCCGATTTGCGATTCTGTATTTCACTATGCTGGTTCTGTTCCTCATCCTT
CTCATTGCTCCTCTGGTTGCCCGGGATGAAGGCATCAGCGTGAACCTCAACATCATGAGC
CTTATGCAGCCTCTGGATACCGACAATAACGATACCATCTCCAGTTACACTGGTAATGGT
CTCCCTGTCGGTTACTCTGCCTGGACCCCGTCCGCGGCGTCTGCATCTGCTTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDA2QLK4
UniProtKB Entry NameFKS1_ASPNC
General References
  1. Pel HJ, de Winde JH, Archer DB, Dyer PS, Hofmann G, Schaap PJ, Turner G, de Vries RP, Albang R, Albermann K, Andersen MR, Bendtsen JD, Benen JA, van den Berg M, Breestraat S, Caddick MX, Contreras R, Cornell M, Coutinho PM, Danchin EG, Debets AJ, Dekker P, van Dijck PW, van Dijk A, Dijkhuizen L, Driessen AJ, d'Enfert C, Geysens S, Goosen C, Groot GS, de Groot PW, Guillemette T, Henrissat B, Herweijer M, van den Hombergh JP, van den Hondel CA, van der Heijden RT, van der Kaaij RM, Klis FM, Kools HJ, Kubicek CP, van Kuyk PA, Lauber J, Lu X, van der Maarel MJ, Meulenberg R, Menke H, Mortimer MA, Nielsen J, Oliver SG, Olsthoorn M, Pal K, van Peij NN, Ram AF, Rinas U, Roubos JA, Sagt CM, Schmoll M, Sun J, Ussery D, Varga J, Vervecken W, van de Vondervoort PJ, Wedler H, Wosten HA, Zeng AP, van Ooyen AJ, Visser J, Stam H: Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88. Nat Biotechnol. 2007 Feb;25(2):221-31. Epub 2007 Jan 28. [PubMed:17259976]
  2. Damveld RA, vanKuyk PA, Arentshorst M, Klis FM, van den Hondel CA, Ram AF: Expression of agsA, one of five 1,3-alpha-D-glucan synthase-encoding genes in Aspergillus niger, is induced in response to cell wall stress. Fungal Genet Biol. 2005 Feb;42(2):165-77. Epub 2004 Dec 31. [PubMed:15670714]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00362Anidulafunginapproved, investigationalyesinhibitorDetails
DB00520CaspofunginapprovedyesinhibitorDetails
DB01141Micafunginapproved, investigationalyesinhibitorDetails