Importin-7, putative

Details

Name
Importin-7, putative
Synonyms
Not Available
Gene Name
Not Available
Organism
Plasmodium falciparum (isolate 3D7)
Amino acid sequence
>lcl|BSEQ0051440|Importin-7, putative
MQNLLNTSKLCEVLEGSISASKEKRIECEEYLKQITKVDGYMNVILNIVKSINVVDDNIR
ISASIFLKNSIRNNYDVLKKEEVCTLTKDIYESLLYLEMKDKQLYIQLFEIMKILIHNNF
PDNFSLLENILEDMNQRKDFRRLYVSLYCLKLIFKKLKIKKKENNELYIDILNKYFYPLI
NCLYDLSMLDLNNNDVSEILSLICKIYYYVNDSYLIKEVIILEYMDNYFSLFDFILKNEI
IVTNYIEDENYLKKLPQFKCKRIVLDIITRLFSRYVNTNYNKFNNDITKKFCDVFLNKWL
CPFFEDFIINLQNYDKNKKTLTDECLIYILQGLSYGVENALIYKNYIKNNFDFLVRSIIF
PLLCYNNEDIEKLLYDEYDYTMNIFNTYVVEDKKVSASSFIKDLTRYRGVKHISELFALC
ENIISTYNENYTKIYSTSHNVTNENDQFTQLEELLNNEYCKYKYGALKILECLYNRLCDK
KRNMNIEQFLKTYVENDLNSPNYLLCYQSIVTYSCFIKKVQSFSDINGLLRNYEIILNHM
GSSSLLIRVASASYIKKFFKIKNEYLKNAIIKTIPLLIERLLNVIKEIKCEYIVMTLDNL
AYTYKDYITPYVNDVVVALCTSFVFLINKKDVEANIKNSLEYNLRNNSHTNNNSNYNSNS
NNNSHHMHHHHHHHFHNNNDITMNSMSDNSFIKQKYSTLMNEKKEKKNENEELDLNSVIL
SILTAILSLLDSVDEENKVQIYKNTISYLYVVVDETFKSPSIDYLEEALSLLTNITYYLD
IDEQVYKRFEKLYDIFYFNTDDNLKMQELNMIRTNPQIILNNEILISDKNSDAYFYDFIF
DLSFSIGVFDNIISKATESFVQMYSHEYGMKYIHMVYRLGMFALHSKIVKSACKLFFILF
EATVKIRGVDELIIPVLNAFSMKLFKHDEAQALMNQKKKESLENNDGADSICSEYDEDIL
SKTSLEYIRKLFYSIIIYNVDQFFLFFNNINKTNVILMFLSNLNDIKINNTRKLYILAMS
NILENMHNANISIHINEINTFMLNLVNIANLYYENKNVKEMSEKSFDSDTSSIDDNSEVD
IDENEDATNEKAYKLIKTIEALEKKNDLKIKLKDNVTLDNIVTAQTQNFNKEIKKHNNNH
DDADYDDDEDDDDDDDDAYYDYDDCSDYSNDEYRKGFFDDINAFKILYDTTTNFYNKYQN
TYNNEILGKMKYLVDADHNNELQQKTQDK
Number of residues
1229
Molecular Weight
145507.21
Theoretical pI
Not Available
GO Classification
Functions
protein transporter activity / Ran GTPase binding
Processes
transcription factor import into nucleus
Components
cytosol / nuclear envelope
General Function
Not Available
Specific Function
Protein transporter activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0051441|Importin-7, putative
ATGCAGAACCTTTTAAATACCAGCAAATTATGTGAAGTGCTCGAGGGTTCCATCAGCGCT
TCAAAGGAGAAAAGAATTGAATGTGAAGAATACTTAAAACAAATAACTAAGGTTGATGGT
TATATGAATGTTATATTAAACATAGTGAAGAGTATTAATGTTGTTGATGACAATATTAGG
ATATCAGCTTCCATATTTTTAAAGAATAGTATTAGAAACAATTATGATGTATTGAAAAAA
GAAGAAGTATGTACTTTAACAAAAGATATATATGAAAGCTTATTATATTTAGAAATGAAA
GATAAACAATTATATATTCAATTATTTGAAATAATGAAAATTTTAATACATAATAATTTC
CCAGATAATTTTTCGCTATTAGAAAATATTTTAGAAGATATGAATCAAAGAAAAGATTTC
CGTAGACTATATGTAAGTTTATATTGTTTAAAATTAATATTTAAGAAATTAAAAATAAAA
AAGAAAGAGAATAATGAATTATATATAGATATATTGAATAAATATTTTTATCCATTGATT
AATTGTTTATATGATTTAAGTATGTTAGATTTAAATAATAATGATGTTAGTGAAATTTTA
AGTTTAATTTGTAAAATATACTATTATGTGAATGATAGTTATTTAATAAAAGAAGTTATC
ATATTAGAATATATGGATAATTATTTCAGCTTATTTGATTTTATATTAAAGAATGAAATT
ATAGTTACAAATTATATTGAAGATGAGAATTATTTAAAAAAATTACCACAATTTAAATGT
AAAAGAATAGTATTAGATATTATAACTCGTTTATTTTCCAGATATGTAAATACGAATTAT
AATAAATTTAATAATGATATTACAAAAAAATTTTGTGATGTATTCTTGAACAAATGGTTA
TGTCCATTCTTTGAAGACTTCATAATTAATTTACAAAATTATGACAAAAATAAAAAAACT
TTAACAGACGAATGTTTAATATATATATTACAAGGATTATCATATGGTGTTGAAAATGCA
TTAATATATAAAAATTATATAAAAAATAATTTTGATTTTCTAGTTCGAAGTATAATTTTT
CCATTATTATGTTATAATAATGAAGATATTGAAAAATTATTATATGATGAATATGATTAT
ACTATGAATATATTTAATACTTATGTAGTCGAAGATAAAAAGGTAAGTGCCAGCTCTTTT
ATAAAAGATTTAACAAGATATAGAGGTGTTAAACATATATCAGAATTATTTGCTTTATGC
GAAAATATTATAAGTACATATAATGAAAATTATACCAAAATTTATAGTACTAGTCATAAT
GTTACTAATGAAAATGATCAATTCACCCAATTAGAAGAATTATTAAATAATGAATATTGT
AAGTATAAATATGGTGCTTTAAAAATATTAGAATGTTTATATAATCGTCTATGTGATAAG
AAAAGAAATATGAACATTGAACAATTTTTAAAAACTTATGTAGAAAATGATTTAAATAGT
CCGAATTATTTATTATGCTATCAATCAATTGTAACTTATTCTTGTTTTATTAAAAAAGTA
CAATCCTTCTCAGATATAAATGGTTTATTAAGAAACTATGAAATCATTCTTAATCATATG
GGTAGTTCAAGTTTATTAATTAGAGTAGCTAGTGCATCATATATTAAGAAATTCTTTAAG
ATCAAAAATGAATATTTAAAAAATGCAATCATAAAAACCATTCCTTTACTTATTGAACGT
TTATTAAATGTAATAAAAGAAATTAAATGTGAATATATTGTTATGACCTTAGATAATTTA
GCATATACATATAAAGATTATATAACACCATATGTAAATGATGTTGTAGTTGCATTATGT
ACAAGTTTTGTATTCCTTATAAATAAAAAAGATGTTGAAGCAAATATTAAGAATTCATTA
GAATATAATTTAAGAAATAATAGCCATACTAATAATAATAGTAATTATAATAGTAATAGT
AATAATAATAGTCATCATATGCATCATCATCATCATCACCATTTTCATAATAATAATGAT
ATAACAATGAATAGTATGAGTGATAATTCTTTTATTAAACAAAAATATAGTACCCTTATG
AATGAAAAAAAAGAAAAAAAAAATGAAAATGAAGAATTAGATTTAAATTCTGTTATTTTA
TCTATATTAACAGCAATCTTAAGTTTATTAGATTCAGTAGATGAAGAAAATAAAGTACAA
ATTTATAAAAATACCATATCTTATTTATATGTAGTTGTTGATGAAACCTTTAAATCACCT
TCTATTGATTATTTAGAAGAAGCATTATCCTTATTAACAAATATAACATATTATTTAGAT
ATAGATGAACAAGTATATAAACGTTTTGAAAAGTTATATGATATATTTTATTTTAATACA
GATGATAATTTGAAAATGCAAGAATTGAATATGATACGAACAAATCCACAAATTATTTTA
AACAATGAAATCTTGATTAGTGATAAAAACAGTGATGCATATTTTTATGATTTCATTTTT
GATTTATCATTTTCTATAGGTGTATTTGATAATATAATATCTAAAGCAACAGAAAGTTTT
GTTCAAATGTATAGTCATGAATATGGAATGAAATATATTCATATGGTGTATAGGTTAGGT
ATGTTTGCTTTACATTCCAAAATTGTTAAAAGTGCATGCAAACTATTCTTTATACTATTT
GAAGCTACTGTAAAAATAAGAGGAGTAGATGAATTGATAATACCTGTGCTAAATGCTTTT
TCTATGAAATTATTTAAACATGATGAAGCACAAGCTCTTATGAATCAGAAAAAAAAAGAA
TCTTTAGAAAATAATGATGGTGCAGATAGTATATGTAGTGAATATGATGAAGATATTTTG
AGTAAAACAAGTCTAGAATATATTAGGAAATTATTTTATTCAATTATTATTTATAATGTT
GATCAATTCTTTTTATTCTTTAATAATATAAATAAGACAAATGTTATATTAATGTTCTTG
TCTAATCTAAATGATATCAAAATTAATAATACAAGGAAATTGTATATACTAGCCATGAGT
AATATATTAGAAAATATGCACAATGCTAATATTAGTATTCATATTAATGAAATTAATACA
TTTATGCTCAACCTAGTTAATATAGCTAATTTATATTATGAAAATAAAAATGTCAAAGAA
ATGTCTGAAAAATCATTCGATTCAGATACATCATCTATTGATGATAATAGTGAAGTCGAT
ATAGATGAAAATGAGGATGCCACAAATGAAAAGGCATATAAATTAATTAAAACTATTGAA
GCCTTAGAAAAAAAAAATGATCTAAAAATAAAATTAAAAGATAATGTTACATTAGATAAT
ATTGTTACTGCTCAAACACAAAATTTTAATAAAGAAATCAAAAAACATAATAATAATCAT
GATGATGCAGATTATGATGACGATGAAGATGACGATGATGATGATGATGACGCATATTAT
GATTATGATGATTGTTCCGATTATAGTAATGATGAATATAGAAAAGGATTCTTTGATGAT
ATTAATGCATTCAAAATTTTATATGATACTACAACAAACTTTTATAATAAGTATCAAAAT
ACTTATAATAATGAAATATTGGGAAAAATGAAATATCTAGTTGATGCAGATCATAATAAT
GAGTTACAACAAAAAACACAAGATAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDC0H4L1
UniProtKB Entry NameC0H4L1_PLAF7
General References
  1. Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [PubMed:12368864]
  2. Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R, Baker S, Barron A, Brooks K, Buckee CO, Burrows C, Cherevach I, Chillingworth C, Chillingworth T, Christodoulou Z, Clark L, Clark R, Corton C, Cronin A, Davies R, Davis P, Dear P, Dearden F, Doggett J, Feltwell T, Goble A, Goodhead I, Gwilliam R, Hamlin N, Hance Z, Harper D, Hauser H, Hornsby T, Holroyd S, Horrocks P, Humphray S, Jagels K, James KD, Johnson D, Kerhornou A, Knights A, Konfortov B, Kyes S, Larke N, Lawson D, Lennard N, Line A, Maddison M, McLean J, Mooney P, Moule S, Murphy L, Oliver K, Ormond D, Price C, Quail MA, Rabbinowitsch E, Rajandream MA, Rutter S, Rutherford KM, Sanders M, Simmonds M, Seeger K, Sharp S, Smith R, Squares R, Squares S, Stevens K, Taylor K, Tivey A, Unwin L, Whitehead S, Woodward J, Sulston JE, Craig A, Newbold C, Barrell BG: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13. Nature. 2002 Oct 3;419(6906):527-31. [PubMed:12368867]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11638Artenimolexperimental, investigationalunknownligandDetails