40S ribosomal protein S19

Details

Name
40S ribosomal protein S19
Synonyms
Not Available
Gene Name
Not Available
Organism
Plasmodium falciparum (isolate 3D7)
Amino acid sequence
>lcl|BSEQ0051408|40S ribosomal protein S19
MEDANKPKKRTFRTFQYRGVDLDKLLDLSQDELIKLFKARQRRKFQRGISKKAKSLLKKI
RKSKKNCEPGEKPNPVPTHLRNMTIIPEMVGSIVAVHNGKQYTNVEIKPEMIGYYLGEFS
ITYKHTRHGKPGIGATHSSRFIPLK
Number of residues
145
Molecular Weight
16763.56
Theoretical pI
Not Available
GO Classification
Functions
RNA binding / structural constituent of ribosome
Processes
ribosomal small subunit assembly / translation
Components
cytosolic small ribosomal subunit
General Function
Not Available
Specific Function
Rna binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0051409|40S ribosomal protein S19
ATGGAGGATGCAAATAAGCCCAAGAAGAGAACCTTTCGTACCTTTCAATATAGAGGTGTT
GATTTAGATAAGTTATTAGACTTAAGCCAAGATGAACTTATAAAATTATTTAAAGCAAGA
CAAAGAAGAAAGTTCCAAAGAGGAATAAGCAAGAAAGCTAAATCACTTTTAAAAAAAATT
AGAAAATCTAAAAAAAATTGTGAACCAGGAGAAAAGCCAAATCCTGTCCCTACCCATTTA
AGAAATATGACCATCATACCAGAAATGGTAGGATCTATTGTAGCTGTACATAATGGTAAA
CAATATACGAATGTAGAAATTAAACCAGAAATGATTGGTTATTATCTTGGTGAATTTTCA
ATTACTTATAAACACACAAGACATGGAAAACCAGGTATTGGAGCTACACATTCATCTCGT
TTCATTCCATTAAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDC0H5C2
UniProtKB Entry NameC0H5C2_PLAF7
General References
  1. Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [PubMed:12368864]
  2. Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R, Baker S, Barron A, Brooks K, Buckee CO, Burrows C, Cherevach I, Chillingworth C, Chillingworth T, Christodoulou Z, Clark L, Clark R, Corton C, Cronin A, Davies R, Davis P, Dear P, Dearden F, Doggett J, Feltwell T, Goble A, Goodhead I, Gwilliam R, Hamlin N, Hance Z, Harper D, Hauser H, Hornsby T, Holroyd S, Horrocks P, Humphray S, Jagels K, James KD, Johnson D, Kerhornou A, Knights A, Konfortov B, Kyes S, Larke N, Lawson D, Lennard N, Line A, Maddison M, McLean J, Mooney P, Moule S, Murphy L, Oliver K, Ormond D, Price C, Quail MA, Rabbinowitsch E, Rajandream MA, Rutter S, Rutherford KM, Sanders M, Simmonds M, Seeger K, Sharp S, Smith R, Squares R, Squares S, Stevens K, Taylor K, Tivey A, Unwin L, Whitehead S, Woodward J, Sulston JE, Craig A, Newbold C, Barrell BG: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13. Nature. 2002 Oct 3;419(6906):527-31. [PubMed:12368867]
  3. Wong W, Bai XC, Brown A, Fernandez IS, Hanssen E, Condron M, Tan YH, Baum J, Scheres SH: Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine. Elife. 2014 Jun 9;3. doi: 10.7554/eLife.03080. [PubMed:24913268]
  4. Sun M, Li W, Blomqvist K, Das S, Hashem Y, Dvorin JD, Frank J: Dynamical features of the Plasmodium falciparum ribosome during translation. Nucleic Acids Res. 2015 Dec 2;43(21):10515-24. doi: 10.1093/nar/gkv991. Epub 2015 Oct 1. [PubMed:26432834]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11638Artenimolexperimental, investigationalunknownligandDetails