Metabotropic glutamate receptor 8

Details

Name
Metabotropic glutamate receptor 8
Synonyms
  • GPRC1H
  • MGLUR8
Gene Name
GRM8
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001666|Metabotropic glutamate receptor 8
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
Number of residues
908
Molecular Weight
101739.575
Theoretical pI
8.21
GO Classification
Functions
G-protein coupled receptor activity / glutamate receptor activity / group III metabotropic glutamate receptor activity
Processes
adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway / negative regulation of cAMP biosynthetic process / regulation of synaptic transmission, glutamatergic / sensory perception of smell / visual perception
Components
integral component of plasma membrane / plasma membrane / presynaptic membrane
General Function
Group iii metabotropic glutamate receptor activity
Specific Function
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
Pfam Domain Function
Transmembrane Regions
584-608 621-641 648-668 696-716 747-768 782-803 819-843
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010588|Metabotropic glutamate receptor 8 (GRM8)
ATGGTATGCGAGGGAAAGCGATCAGCCTCTTGCCCTTGTTTCTTCCTCTTGACCGCCAAG
TTCTACTGGATCCTCACAATGATGCAAAGAACTCACAGCCAGGAGTATGCCCATTCCATA
CGGGTGGATGGGGACATTATTTTGGGGGGTCTCTTCCCTGTCCACGCAAAGGGAGAGAGA
GGGGTGCCTTGTGGGGAGCTGAAGAAGGAAAAGGGGATTCACAGACTGGAGGCCATGCTT
TATGCAATTGACCAGATTAACAAGGACCCTGATCTCCTTTCCAACATCACTCTGGGTGTC
CGCATCCTCGACACGTGCTCTAGGGACACCTATGCTTTGGAGCAGTCTCTAACATTCGTG
CAGGCATTAATAGAGAAAGATGCTTCGGATGTGAAGTGTGCTAATGGAGATCCACCCATT
TTCACCAAGCCCGACAAGATTTCTGGCGTCATAGGTGCTGCAGCAAGCTCCGTGTCCATC
ATGGTTGCTAACATTTTAAGACTTTTTAAGATACCTCAAATCAGCTATGCATCCACAGCC
CCAGAGCTAAGTGATAACACCAGGTATGACTTTTTCTCTCGAGTGGTTCCGCCTGACTCC
TACCAAGCCCAAGCCATGGTGGACATCGTGACAGCACTGGGATGGAATTATGTTTCGACA
CTGGCTTCTGAGGGGAACTATGGTGAGAGCGGTGTGGAGGCCTTCACCCAGATCTCGAGG
GAGATTGGTGGTGTTTGCATTGCTCAGTCACAGAAAATCCCACGTGAACCAAGACCTGGA
GAATTTGAAAAAATTATCAAACGCCTGCTAGAAACACCTAATGCTCGAGCAGTGATTATG
TTTGCCAATGAGGATGACATCAGGAGGATATTGGAAGCAGCAAAAAAACTAAACCAAAGT
GGGCATTTTCTCTGGATTGGCTCAGATAGTTGGGGATCCAAAATAGCACCTGTCTATCAG
CAAGAGGAGATTGCAGAAGGGGCTGTGACAATTTTGCCCAAACGAGCATCAATTGATGGA
TTTGATCGATACTTTAGAAGCCGAACTCTTGCCAATAATCGAAGAAATGTGTGGTTTGCA
GAATTCTGGGAGGAGAATTTTGGCTGCAAGTTAGGATCACATGGGAAAAGGAACAGTCAT
ATAAAGAAATGCACAGGGCTGGAGCGAATTGCTCGGGATTCATCTTATGAACAGGAAGGA
AAGGTCCAATTTGTAATTGATGCTGTATATTCCATGGCTTACGCCCTGCACAATATGCAC
AAAGATCTCTGCCCTGGATACATTGGCCTTTGTCCACGAATGAGTACCATTGATGGGAAA
GAGCTACTTGGTTATATTCGGGCTGTAAATTTTAATGGCAGTGCTGGCACTCCTGTCACT
TTTAATGAAAACGGAGATGCTCCTGGACGTTATGATATCTTCCAGTATCAAATAACCAAC
AAAAGCACAGAGTACAAAGTCATCGGCCACTGGACCAATCAGCTTCATCTAAAAGTGGAA
GACATGCAGTGGGCTCATAGAGAACATACTCACCCGGCGTCTGTCTGCAGCCTGCCGTGT
AAGCCAGGGGAGAGGAAGAAAACGGTGAAAGGGGTCCCTTGCTGCTGGCACTGTGAACGC
TGTGAAGGTTACAACTACCAGGTGGATGAGCTGTCCTGTGAACTTTGCCCTCTGGATCAG
AGACCCAACATGAACCGCACAGGCTGCCAGCTTATCCCCATCATCAAATTGGAGTGGCAT
TCTCCCTGGGCTGTGGTGCCTGTGTTTGTTGCAATATTGGGAATCATCGCCACCACCTTT
GTGATCGTGACCTTTGTCCGCTATAATGACACACCTATCGTGAGGGCTTCAGGACGCGAA
CTTAGTTACGTGCTCCTAACGGGGATTTTTCTCTGTTATTCAATCACGTTTTTAATGATT
GCAGCACCAGATACAATCATATGCTCCTTCCGACGGGTCTTCCTAGGACTTGGCATGTGT
TTCAGCTATGCAGCCCTTCTGACCAAAACAAACCGTATCCACCGAATATTTGAGCAGGGG
AAGAAATCTGTCACAGCGCCCAAGTTCATTAGTCCAGCATCTCAGCTGGTGATCACCTTC
AGCCTCATCTCCGTCCAGCTCCTTGGAGTGTTTGTCTGGTTTGTTGTGGATCCCCCCCAC
ATCATCATTGACTATGGAGAGCAGCGGACACTAGATCCAGAGAAGGCCAGGGGAGTGCTC
AAGTGTGACATTTCTGATCTCTCACTCATTTGTTCACTTGGATACAGTATCCTCTTGATG
GTCACTTGTACTGTTTATGCCATTAAAACGAGAGGTGTCCCAGAGACTTTCAATGAAGCC
AAACCTATTGGATTTACCATGTATACCACCTGCATCATTTGGTTAGCTTTCATCCCCATC
TTTTTTGGTACAGCCCAGTCAGCAGAAAAGATGTACATCCAGACAACAACACTTACTGTC
TCCATGAGTTTAAGTGCTTCAGTATCTCTGGGCATGCTCTATATGCCCAAGGTTTATATT
ATAATTTTTCATCCAGAACAGAATGTTCAAAAACGCAAGAGGAGCTTCAAGGCTGTGGTG
ACAGCTGCCACCATGCAAAGCAAACTGATCCAAAAAGGAAATGACAGACCAAATGGCGAG
GTGAAAAGTGAACTCTGTGAGAGTCTTGAAACCAACACTTCCTCTACCAAGACAACATAT
ATCAGTTACAGCAATCATTCAATCTGA
Chromosome Location
7
Locus
7q31.3-q32.1
External Identifiers
ResourceLink
UniProtKB IDO00222
UniProtKB Entry NameGRM8_HUMAN
GenBank Protein ID1935043
GenBank Gene IDU92459
GenAtlas IDGRM8
HGNC IDHGNC:4600
General References
  1. Scherer SW, Soder S, Duvoisin RM, Huizenga JJ, Tsui LC: The human metabotropic glutamate receptor 8 (GRM8) gene: a disproportionately large gene located at 7q31.3-q32.1. Genomics. 1997 Sep 1;44(2):232-6. [PubMed:9299241]
  2. Wu S, Wright RA, Rockey PK, Burgett SG, Arnold JS, Rosteck PR Jr, Johnson BG, Schoepp DD, Belagaje RM: Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells. Brain Res Mol Brain Res. 1998 Jan;53(1-2):88-97. [PubMed:9473604]
  3. Malherbe P, Kratzeisen C, Lundstrom K, Richards JG, Faull RL, Mutel V: Cloning and functional expression of alternative spliced variants of the human metabotropic glutamate receptor 8. Brain Res Mol Brain Res. 1999 Apr 20;67(2):201-10. [PubMed:10216218]
  4. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00142Glutamic acidapproved, nutraceuticalunknownDetails