Fatty-acid amide hydrolase 1

Details

Name
Fatty-acid amide hydrolase 1
Synonyms
  • 3.5.1.99
  • Anandamide amidohydrolase 1
  • FAAH1
  • Oleamide hydrolase 1
Gene Name
FAAH
Organism
Humans
Amino acid sequence
>lcl|BSEQ0011585|Fatty-acid amide hydrolase 1
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
Number of residues
579
Molecular Weight
63065.28
Theoretical pI
7.72
GO Classification
Functions
acylglycerol lipase activity / carbon-nitrogen ligase activity, with glutamine as amido-N-donor / fatty acid amide hydrolase activity
Processes
arachidonic acid metabolic process / fatty acid catabolic process / small molecule metabolic process
Components
cytoskeleton / endoplasmic reticulum membrane / integral component of membrane / organelle membrane
General Function
Fatty acid amide hydrolase activity
Specific Function
Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
Pfam Domain Function
Transmembrane Regions
9-29
Cellular Location
Endomembrane system
Gene sequence
>lcl|BSEQ0011586|Fatty-acid amide hydrolase 1 (FAAH)
ATGGTGCAGTACGAGCTGTGGGCCGCGCTGCCTGGCGCCTCCGGGGTCGCCCTGGCCTGC
TGCTTCGTGGCGGCGGCCGTGGCCCTGCGCTGGTCCGGGCGCCGGACGGCGCGGGGCGCG
GTGGTCCGGGCGCGACAGAGGCAGCGAGCGGGCCTGGAGAACATGGACAGGGCGGCGCAG
CGCTTCCGGCTCCAGAACCCAGACCTGGACTCAGAGGCGCTGCTAGCCCTGCCCCTGCCT
CAGCTGGTGCAGAAGTTACACAGTAGAGAGCTGGCCCCTGAGGCCGTGCTCTTCACCTAT
GTGGGAAAGGCCTGGGAAGTGAACAAAGGGACCAACTGTGTGACCTCCTATCTGGCTGAC
TGTGAGACTCAGCTGTCTCAGGCCCCAAGGCAGGGCCTGCTCTATGGCGTCCCTGTGAGC
CTCAAGGAGTGCTTCACCTACAAGGGCCAGGACTCCACGCTGGGCTTGAGCCTGAATGAA
GGGGTGCCGGCGGAGTGCGACAGCGTAGTGGTGCATGTGCTGAAGCTGCAGGGTGCCGTG
CCCTTCGTGCACACCAATGTTCCACAGTCCATGTTCAGCTATGACTGCAGTAACCCCCTC
TTTGGCCAGACCGTGAACCCATGGAAGTCCTCCAAAAGCCCAGGGGGCTCCTCAGGGGGT
GAAGGGGCCCTCATCGGGTCTGGAGGCTCCCCCCTGGGCTTAGGCACTGATATCGGAGGC
AGCATCCGCTTCCCCTCCTCCTTCTGCGGCATCTGCGGCCTCAAGCCCACAGGGAACCGC
CTCAGCAAGAGTGGCCTGAAGGGCTGTGTCTATGGACAGGAGGCAGTGCGTCTCTCCGTG
GGCCCCATGGCCCGGGACGTGGAGAGCCTGGCACTGTGCCTGCGAGCCCTGCTGTGCGAG
GACATGTTCCGCTTGGACCCCACTGTGCCTCCCTTGCCCTTCAGAGAAGAGGTCTACACC
AGCTCTCAGCCCCTGCGTGTGGGGTACTATGAGACTGACAACTATACCATGCCCTCCCCG
GCCATGAGGCGGGCCGTGCTGGAGACCAAACAGAGCCTTGAGGCTGCGGGGCACACGCTG
GTTCCCTTCTTGCCAAGCAACATACCCCATGCTCTGGAGACCCTGTCAACAGGTGGGCTC
TTCAGTGATGGTGGCCACACCTTCCTACAGAACTTCAAAGGTGATTTCGTGGACCCCTGC
CTGGGGGACCTGGTCTCAATTCTGAAGCTTCCCCAATGGCTTAAAGGACTGCTGGCCTTC
CTGGTGAAGCCTCTGCTGCCAAGGCTGTCAGCTTTCCTCAGCAACATGAAGTCTCGTTCG
GCTGGAAAACTCTGGGAACTGCAGCACGAGATCGAGGTGTACCGCAAAACCGTGATTGCC
CAGTGGAGGGCGCTGGACCTGGATGTGGTGCTGACCCCCATGCTGGCCCCTGCTCTGGAC
TTGAATGCCCCAGGCAGGGCCACAGGGGCCGTCAGCTACACTATGCTGTACAACTGCCTG
GACTTCCCTGCAGGGGTGGTGCCTGTCACCACGGTGACTGCTGAGGACGAGGCCCAGATG
GAACATTACAGGGGCTACTTTGGGGATATCTGGGACAAGATGCTGCAGAAGGGCATGAAG
AAGAGTGTGGGGCTGCCGGTGGCCGTGCAGTGTGTGGCTCTGCCCTGGCAAGAAGAGTTG
TGTCTGCGGTTCATGCGGGAGGTGGAGCGACTGATGACCCCTGAAAAGCAGTCATCCTGA
Chromosome Location
1
Locus
1p35-p34
External Identifiers
ResourceLink
UniProtKB IDO00519
UniProtKB Entry NameFAAH1_HUMAN
GenBank Protein ID2149156
GenBank Gene IDU82535
GenAtlas IDFAAH
HGNC IDHGNC:3553
General References
  1. Giang DK, Cravatt BF: Molecular characterization of human and mouse fatty acid amide hydrolases. Proc Natl Acad Sci U S A. 1997 Mar 18;94(6):2238-42. [PubMed:9122178]
  2. Wan M, Cravatt BF, Ring HZ, Zhang X, Francke U: Conserved chromosomal location and genomic structure of human and mouse fatty-acid amide hydrolase genes and evaluation of clasper as a candidate neurological mutation. Genomics. 1998 Dec 15;54(3):408-14. [PubMed:9878243]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801]
  6. Wei BQ, Mikkelsen TS, McKinney MK, Lander ES, Cravatt BF: A second fatty acid amide hydrolase with variable distribution among placental mammals. J Biol Chem. 2006 Dec 1;281(48):36569-78. Epub 2006 Oct 2. [PubMed:17015445]
  7. Sipe JC, Chiang K, Gerber AL, Beutler E, Cravatt BF: A missense mutation in human fatty acid amide hydrolase associated with problem drug use. Proc Natl Acad Sci U S A. 2002 Jun 11;99(12):8394-9. [PubMed:12060782]
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  9. Chiang KP, Gerber AL, Sipe JC, Cravatt BF: Reduced cellular expression and activity of the P129T mutant of human fatty acid amide hydrolase: evidence for a link between defects in the endocannabinoid system and problem drug use. Hum Mol Genet. 2004 Sep 15;13(18):2113-9. Epub 2004 Jul 14. [PubMed:15254019]
  10. Flanagan JM, Gerber AL, Cadet JL, Beutler E, Sipe JC: The fatty acid amide hydrolase 385 A/A (P129T) variant: haplotype analysis of an ancient missense mutation and validation of risk for drug addiction. Hum Genet. 2006 Nov;120(4):581-8. Epub 2006 Sep 14. [PubMed:16972078]
  11. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]
  12. Sim MS, Hatim A, Reynolds GP, Mohamed Z: Association of a functional FAAH polymorphism with methamphetamine-induced symptoms and dependence in a Malaysian population. Pharmacogenomics. 2013 Apr;14(5):505-14. doi: 10.2217/pgs.13.25. [PubMed:23556448]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02465Methoxy arachidonyl fluorophosphonateexperimentalunknownDetails
DB00599Thiopentalapproved, vet_approvedunknowninhibitorDetails
DB00818Propofolapproved, investigational, vet_approvedunknownsubstrateDetails
DB068941-DODECANOLexperimentalunknownDetails
DB083854-(quinolin-3-ylmethyl)piperidine-1-carboxylic acidexperimentalunknownDetails
DB084004-(3-{[5-(trifluoromethyl)pyridin-2-yl]oxy}benzyl)piperidine-1-carboxylic acidexperimentalunknownDetails
DB00316AcetaminophenapprovedunknownsubstrateDetails
DB09061Cannabidiolapproved, investigationalunknowninhibitorDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails