FMN-dependent NADPH-azoreductase

Details

Name
FMN-dependent NADPH-azoreductase
Synonyms
  • 1.7.-.-
  • Azobenzene reductase
  • yhdA
Gene Name
azr
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0012121|FMN-dependent NADPH-azoreductase
MNMLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVLPVFNGEAEQSELLKVQELKQR
VTKADAIVLLSPEYHSGMSGALKNALDFLSSEQFKYKPVALLAVAGGGKGGINALNNMRT
VMRGVYANVIPKQLVLDPVHIDVENATVAENIKESIKELVEELSMFAKAGNPGV
Number of residues
174
Molecular Weight
18903.755
Theoretical pI
6.97
GO Classification
Functions
identical protein binding / oxidoreductase activity
General Function
Oxidoreductase activity
Specific Function
Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADPH, but not NADH, as an electron donor for its activity.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012122|FMN-dependent NADPH-azoreductase (azr)
ATGAACATGTTAGTCATAAATGGCACGCCAAGAAAACATGGCAGAACAAGAATTGCAGCA
TCCTATATTGCAGCTCTGTATCACACGGATTTGATTGATCTAAGCGAGTTTGTATTGCCC
GTTTTTAACGGTGAAGCGGAACAATCTGAACTGTTGAAAGTACAGGAGCTTAAGCAACGC
GTTACGAAAGCGGATGCGATTGTATTATTATCGCCTGAATATCACAGCGGCATGAGCGGC
GCTTTAAAAAATGCCTTGGATTTTCTAAGCAGCGAACAATTCAAATATAAGCCCGTTGCA
TTATTGGCAGTAGCGGGAGGCGGAAAAGGCGGCATCAATGCGCTGAACAATATGAGAACT
GTGATGCGGGGTGTCTACGCCAATGTCATTCCGAAGCAGCTGGTGCTTGATCCGGTGCAT
ATTGATGTTGAAAATGCTACAGTGGCTGAAAACATTAAGGAAAGCATAAAAGAGCTTGTC
GAAGAACTCAGCATGTTCGCAAAAGCAGGAAATCCCGGCGTCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO07529
UniProtKB Entry NameAZR_BACSU
GenBank Gene IDY14079
General References
  1. Sugiura W, Yoda T, Matsuba T, Tanaka Y, Suzuki Y: Expression and characterization of the genes encoding azoreductases from Bacillus subtilis and Geobacillus stearothermophilus. Biosci Biotechnol Biochem. 2006 Jul;70(7):1655-65. [PubMed:16861800]
  2. Noback MA, Holsappel S, Kiewiet R, Terpstra P, Wambutt R, Wedler H, Venema G, Bron S: The 172 kb prkA-addAB region from 83 degrees to 97 degrees of the Bacillus subtilis chromosome contains several dysfunctional genes, the glyB marker, many genes encoding transporter proteins, and the ubiquitous hit gene. Microbiology. 1998 Apr;144 ( Pt 4):859-75. [PubMed:9579061]
  3. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]
  4. Deller S, Sollner S, Trenker-El-Toukhy R, Jelesarov I, Gubitz GM, Macheroux P: Characterization of a thermostable NADPH:FMN oxidoreductase from the mesophilic bacterium Bacillus subtilis. Biochemistry. 2006 Jun 13;45(23):7083-91. [PubMed:16752898]
  5. Jordan S, Junker A, Helmann JD, Mascher T: Regulation of LiaRS-dependent gene expression in bacillus subtilis: identification of inhibitor proteins, regulator binding sites, and target genes of a conserved cell envelope stress-sensing two-component system. J Bacteriol. 2006 Jul;188(14):5153-66. [PubMed:16816187]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails