Neurocan core protein

Details

Name
Neurocan core protein
Synonyms
  • Chondroitin sulfate proteoglycan 3
  • CSPG3
  • NEUR
Gene Name
NCAN
Organism
Humans
Amino acid sequence
>lcl|BSEQ0020772|Neurocan core protein
MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRR
ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILE
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPMPRRR
GRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSP
WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAH
GEATATAPPSPAAETKVYSLPLSLTPTGQGGEAMPTTPESPRADFRETGETSPAQVNKAE
HSSSSPWPSVNRNVAVGFVPTETATEPTGLRGIPGSESGVFDTAESPTSGLQATVDEVQD
PWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPTVNPMDSTVTPAPSDA
SGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPE
PEDQVETQGTSGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLL
PVTLGIEDFELEVLAGSPGVESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHG
GTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSF
CEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRSGHLTSVHSPEEHSFINSFGH
ENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPC
NYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRS
NGKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNF
C
Number of residues
1321
Molecular Weight
143092.14
Theoretical pI
Not Available
GO Classification
Functions
calcium ion binding / carbohydrate binding / hyaluronic acid binding
Processes
axon guidance / carbohydrate metabolic process / cell adhesion / central nervous system development / chondroitin sulfate biosynthetic process / chondroitin sulfate catabolic process / chondroitin sulfate metabolic process / dermatan sulfate biosynthetic process / extracellular matrix organization / glycosaminoglycan metabolic process / skeletal system development / small molecule metabolic process
Components
extracellular region / Golgi lumen / lysosomal lumen / proteinaceous extracellular matrix
General Function
Hyaluronic acid binding
Specific Function
May modulate neuronal adhesion and neurite growth during development by binding to neural cell adhesion molecules (NG-CAM and N-CAM). Chondroitin sulfate proteoglycan; binds to hyaluronic acid.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0020773|Neurocan core protein (NCAN)
ATGGGGGCCCCGTTTGTCTGGGCCTTGGGCCTTTTGATGCTGCAGATGCTGCTCTTTGTG
GCTGGGGAACAGGGCACACAGGATATCACCGATGCCAGCGAAAGGGGGCTCCACATGCAG
AAGCTGGGGTCTGGGTCAGTGCAGGCTGCGCTGGCGGAGCTGGTGGCCCTGCCCTGTCTC
TTTACCCTGCAGCCACGGCCAAGCGCAGCCCGAGATGCCCCTCGGATAAAGTGGACCAAG
GTGCGGACTGCGTCGGGCCAGCGACAGGACTTGCCCATCCTGGTGGCCAAGGACAATGTC
GTGAGGGTGGCCAAAAGCTGGCAGGGACGAGTGTCACTGCCTTCCTACCCCCGGCGCCGA
GCCAACGCCACGCTACTTCTGGGGCCACTGAGGGCCAGTGACTCTGGGCTGTACCGCTGC
CAGGTGGTGAGGGGCATCGAGGATGAGCAGGACCTGGTGCCCTTGGAGGTGACAGGTGTT
GTGTTCCACTACCGATCAGCCCGGGACCGCTATGCACTGACCTTCGCTGAGGCCCAGGAG
GCCTGCCGTCTCAGCTCAGCCATCATTGCAGCCCCTCGGCATCTACAGGCTGCCTTTGAG
GATGGCTTTGACAACTGTGATGCTGGCTGGCTCTCTGACCGCACTGTTCGGTATCCTATC
ACCCAGTCCCGTCCTGGTTGCTATGGCGACCGTAGCAGCCTTCCAGGGGTTCGGAGCTAT
GGGAGGCGCAACCCACAGGAACTCTACGATGTGTATTGCTTTGCCCGGGAGCTGGGGGGC
GAGGTCTTCTACGTGGGCCCGGCCCGCCGCCTGACACTGGCCGGCGCGCGTGCACAGTGC
CGCCGCCAGGGTGCCGCGCTGGCCTCGGTGGGACAGCTGCACCTGGCCTGGCATGAGGGC
CTGGACCAGTGCGACCCGGGCTGGCTGGCCGACGGCAGCGTGCGCTACCCGATCCAGACG
CCGCGCCGGCGCTGCGGGGGCCCAGCCCCGGGCGTGCGCACCGTCTACCGCTTCGCTAAC
CGGACCGGCTTCCCCTCACCCGCCGAGCGCTTCGACGCCTACTGCTTCCGAGCTCATCAC
CCCACGTCACAACATGGAGACCTAGAGACCCCATCCTCTGGGGATGAGGGGGAGATTCTG
TCAGCAGAGGGGCCCCCAGTTAGAGAACTGGAGCCCACCCTGGAGGAGGAAGAGGTGGTC
ACCCCTGACTTCCAGGAGCCTCTGGTGTCCAGTGGGGAAGAAGAAACCCTGATTTTGGAG
GAGAAGCAGGAGTCTCAACAGACCCTCAGCCCTACCCCTGGGGACCCCATGCTGGCCTCA
TGGCCCACTGGGGAAGTGTGGCTAAGCACGGTGGCCCCCAGCCCTAGCGACATGGGGGCA
GGCACTGCAGCAAGTTCACACACGGAGGTGGCCCCAACTGACCCTATGCCTAGGAGAAGG
GGGCGCTTCAAAGGGTTGAATGGGCGCTACTTCCAGCAGCAGGAACCGGAGCCGGGGCTG
CAAGGGGGGATGGAGGCCAGCGCCCAGCCCCCCACCTCAGAGGCTGCAGTGAACCAAATG
GAGCCTCCGTTGGCCATGGCAGTCACAGAGATGTTGGGCAGTGGCCAGAGCCGGAGCCCC
TGGGCTGATCTGACCAATGAGGTGGATATGCCTGGAGCTGGTTCTGCTGGTGGCAAGAGC
TCCCCAGAGCCCTGGCTGTGGCCCCCTACCATGGTCCCACCCAGCATCTCAGGCCACAGC
AGGGCCCCTGTCCTGGAGCTAGAGAAAGCCGAGGGCCCCAGTGCCAGGCCAGCCACCCCA
GACCTGTTTTGGTCCCCCTTGGAGGCCACTGTCTCAGCTCCCAGCCCTGCCCCCTGGGAG
GCATTCCCTGTGGCCACCTCCCCAGATCTCCCTATGATGGCCATGCTGCGTGGTCCCAAA
GAGTGGATGCTACCACACCCCACCCCCATCTCCACCGAGGCCAATAGAGTTGAGGCACAT
GGTGAGGCCACCGCCACGGCTCCACCCTCCCCTGCTGCAGAGACCAAGGTGTATTCCCTG
CCTCTCTCTTTGACCCCAACAGGACAGGGTGGAGAGGCCATGCCCACAACACCTGAGTCC
CCCAGGGCAGACTTCAGAGAAACTGGGGAGACCAGCCCTGCTCAGGTCAACAAAGCTGAG
CACTCCAGCTCCAGCCCATGGCCTTCTGTAAACAGGAATGTGGCTGTAGGTTTTGTCCCC
ACTGAGACTGCCACTGAGCCAACGGGCCTCAGGGGTATCCCGGGGTCTGAGTCTGGGGTC
TTCGACACAGCAGAAAGCCCCACTTCTGGCTTGCAGGCCACTGTAGATGAGGTGCAGGAC
CCCTGGCCCTCAGTGTACAGCAAAGGGCTGGATGCAAGTTCCCCATCTGCCCCCCTGGGG
AGCCCTGGAGTCTTCTTGGTACCCAAAGTCACCCCAAATTTGGAGCCTTGGGTTGCTACA
GATGAAGGACCCACTGTGAATCCCATGGATTCCACAGTCACGCCGGCCCCCAGTGATGCT
AGTGGAATTTGGGAACCTGGATCCCAGGTGTTTGAAGAAGCCGAAAGCACCACCTTGAGC
CCTCAGGTGGCCCTGGATACAAGCATTGTGACGCCCCTCACGACCCTGGAGCAGGGGGAC
AAGGTTGGAGTTCCAGCCATGTCTACACTGGGCTCCTCAAGCTCCCAACCCCACCCAGAG
CCAGAGGATCAGGTGGAGACCCAGGGAACATCAGGAGCTTCAGTGCCTCCGCATCAGAGC
AGTCCCCTAGGGAAACCGGCTGTTCCTCCTGGGACACCGACTGCAGCCAGTGTGGGCGAG
TCTGCCTCAGTTTCCTCAGGGGAGCCTACGGTACCGTGGGACCCCTCCAGCACCCTGCTG
CCTGTCACCCTGGGCATAGAGGACTTCGAACTGGAGGTCCTGGCAGGGAGCCCGGGTGTA
GAGAGCTTCTGGGAGGAGGTGGCAAGTGGAGAGGAGCCAGCCCTGCCAGGGACCCCTATG
AATGCAGGTGCGGAGGAGGTGCACTCAGATCCCTGTGAGAACAACCCTTGTCTTCATGGA
GGGACATGTAATGCCAATGGCACCATGTATGGCTGTAGCTGTGATCAGGGCTTCGCCGGG
GAGAACTGTGAGATTGACATTGATGACTGCCTCTGCAGCCCCTGTGAGAATGGAGGCACC
TGTATTGATGAGGTCAATGGCTTTGTCTGCCTTTGCCTCCCCAGCTATGGGGGCAGCTTT
TGTGAGAAAGACACCGAGGGCTGTGACCGCGGCTGGCATAAGTTCCAGGGCCACTGTTAC
CGCTATTTTGCCCACCGGAGGGCATGGGAAGATGCCGAGAAGGACTGCCGCCGCCGCTCC
GGCCACCTGACCAGCGTCCACTCACCGGAGGAACACAGCTTCATTAATAGCTTTGGGCAT
GAAAACACGTGGATCGGCCTGAACGACAGGATCGTGGAGAGAGATTTCCAGTGGACGGAC
AACACCGGGCTGCAATTTGAGAACTGGCGAGAGAACCAGCCGGACAATTTCTTCGCGGGT
GGCGAGGACTGTGTGGTGATGGTGGCGCATGAAAGCGGGCGCTGGAACGATGTCCCCTGC
AACTACAACCTACCCTATGTCTGCAAGAAGGGCACAGTGCTCTGTGGTCCCCCTCCGGCA
GTGGAGAATGCCTCACTCATCGGTGCCCGCAAGGCCAAGTACAATGTCCATGCCACTGTA
AGGTACCAGTGCAATGAAGGATTTGCCCAGCACCATGTGGCCACCATTCGATGCCGGAGC
AATGGCAAGTGGGACAGGCCCCAAATTGTCTGCACCAAACCCAGACGTTCACATCGGATG
CGGCGACACCACCACCACCACCAACACCACCACCAGCATCACCACCACAAATCCCGCAAG
GAGCGCAGAAAACACAAGAAACACCCAACGGAGGACTGGGAGAAGGACGAAGGGAATTTC
TGCTGA
Chromosome Location
19
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO14594
UniProtKB Entry NameNCAN_HUMAN
HGNC IDHGNC:2465
General References
  1. Prange CK, Pennacchio LA, Lieuallen K, Fan W, Lennon GG: Characterization of the human neurocan gene, CSPG3. Gene. 1998 Oct 23;221(2):199-205. [PubMed:9795216]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  3. Halim A, Ruetschi U, Larson G, Nilsson J: LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins. J Proteome Res. 2013 Feb 1;12(2):573-84. doi: 10.1021/pr300963h. Epub 2013 Jan 11. [PubMed:23234360]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB04396ThiodigalactosideexperimentalunknownDetails
DB08818Hyaluronic acidapproved, vet_approvedunknownbinderDetails