Cytochrome b-c1 complex subunit 8

Details

Name
Cytochrome b-c1 complex subunit 8
Synonyms
  • Complex III subunit 8
  • Complex III subunit VIII
  • Ubiquinol-cytochrome c reductase complex 9.5 kDa protein
  • Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C
Gene Name
UQCRQ
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017247|Cytochrome b-c1 complex subunit 8
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
TWGTEEFERSKRKNPAAYENDK
Number of residues
82
Molecular Weight
9906.315
Theoretical pI
10.5
GO Classification
Functions
ubiquinol-cytochrome-c reductase activity
Processes
cellular metabolic process / cerebellar Purkinje cell layer development / hippocampus development / hypothalamus development / midbrain development / pons development / pyramidal neuron development / respiratory electron transport chain / small molecule metabolic process / subthalamus development / thalamus development
Components
mitochondrial inner membrane / mitochondrion / respiratory chain
General Function
Ubiquinol-cytochrome-c reductase activity
Specific Function
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Mitochondrion inner membrane
Gene sequence
>lcl|BSEQ0017248|Cytochrome b-c1 complex subunit 8 (UQCRQ)
ATGGGCCGCGAGTTTGGGAATCTGACGCGGATGCGGCATGTGATCAGCTACAGCTTGTCA
CCGTTCGAGCAGCGCGCCTATCCGCACGTCTTCACTAAAGGAATCCCCAATGTTCTGCGC
CGCATTCGGGAGTCTTTCTTTCGCGTGGTGCCGCAGTTTGTAGTGTTTTATCTTATCTAC
ACATGGGGGACTGAAGAGTTCGAGAGATCCAAGAGGAAGAATCCAGCTGCCTATGAAAAT
GACAAATGA
Chromosome Location
5
Locus
5q31.1
External Identifiers
ResourceLink
UniProtKB IDO14949
UniProtKB Entry NameQCR8_HUMAN
GenBank Protein ID2605590
GenBank Gene IDD50369
HGNC IDHGNC:29594
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  2. Schagger H, Brandt U, Gencic S, von Jagow G: Ubiquinol-cytochrome-c reductase from human and bovine mitochondria. Methods Enzymol. 1995;260:82-96. [PubMed:8592474]
  3. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  4. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  5. Barel O, Shorer Z, Flusser H, Ofir R, Narkis G, Finer G, Shalev H, Nasasra A, Saada A, Birk OS: Mitochondrial complex III deficiency associated with a homozygous mutation in UQCRQ. Am J Hum Genet. 2008 May;82(5):1211-6. doi: 10.1016/j.ajhg.2008.03.020. Epub 2008 Apr 24. [PubMed:18439546]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB07401METHYL (2Z)-2-(2-{[6-(2-CYANOPHENOXY)PYRIMIDIN-4-YL]OXY}PHENYL)-3-METHOXYACRYLATEexperimentalunknownDetails
DB041412-Hexyloxy-6-Hydroxymethyl-Tetrahydro-Pyran-3,4,5-TriolexperimentalunknownDetails
DB07763(5S)-3-ANILINO-5-(2,4-DIFLUOROPHENYL)-5-METHYL-1,3-OXAZOLIDINE-2,4-DIONEexperimentalunknownDetails
DB07778FAMOXADONEexperimentalunknownDetails
DB08330METHYL (2Z)-3-METHOXY-2-{2-[(E)-2-PHENYLVINYL]PHENYL}ACRYLATEexperimentalunknownDetails
DB084532-NONYL-4-HYDROXYQUINOLINE N-OXIDEexperimentalunknownDetails
DB047996-Hydroxy-5-undecyl-4,7-benzothiazoledioneexperimentalunknownDetails
DB08690UBIQUINONE-2experimentalunknownDetails