Monocarboxylate transporter 6

Details

Name
Monocarboxylate transporter 6
Synonyms
  • MCT 5
  • MCT 6
  • MCT5
  • MCT6
  • Monocarboxylate transporter 5
  • Solute carrier family 16 member 5
Gene Name
SLC16A5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000769|Monocarboxylate transporter 6
MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILT
AVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCF
SFQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFL
HCCICGAIIRPVATSVAPETKECPPPPPETPALGCLAACGRTIQRHLAFDILRHNTGYCV
YILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISIIGFSNIFLRPLAGLMAGRPAF
ASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIFQVLMDIVPMD
QFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQ
KKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRT
SHEWLLWPKAVLQAKQTALGWNSPT
Number of residues
505
Molecular Weight
54993.04
Theoretical pI
8.28
GO Classification
Functions
lactate transmembrane transporter activity / monocarboxylic acid transmembrane transporter activity / symporter activity
Processes
monocarboxylic acid transport / plasma membrane lactate transport
Components
integral component of plasma membrane / membrane
General Function
Symporter activity
Specific Function
Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).
Pfam Domain Function
Transmembrane Regions
18-38 54-74 81-101 111-131 138-158 172-192 240-260 275-295 306-326 330-350 368-388 397-417
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010270|Monocarboxylate transporter 6 (SLC16A5)
ATGCCCCAGGCCCTGGAGCGTGCAGATGGCAGCTGGGCCTGGGTGGTGCTGCTGGCCACC
ATGGTGACCCAGGGCCTCACCCTGGGCTTCCCCACGTGTATCGGCATCTTCTTCACTGAA
TTGCAATGGGAGTTCCAGGCCAGCAACAGCGAGACCTCTTGGTTCCCCTCCATCCTCACG
GCTGTGCTCCACATGGCAGGGCCCCTGTGCAGCATCCTGGTGGGACGCTTCGGCTGCCGA
GTGACCGTGATGCTGGGGGGCGTGCTGGCCAGCCTGGGCATGGTGGCCAGCTCCTTCTCT
CACAACCTCAGCCAGCTCTACTTCACAGCAGGATTCATCACAGGCCTGGGCATGTGCTTC
AGCTTCCAGTCAAGCATCACGGTGCTGGGCTTCTACTTTGTCCGCCGGCGGGTGCTGGCC
AACGCGCTGGCCTCGATGGGCGTCTCCCTGGGCATCACCCTCTGGCCGCTGCTCTCCCGC
TACCTTCTGGAGAACCTGGGCTGGAGGGGTACCTTCCTTGTCTTCGGCGGGATCTTTCTC
CACTGCTGCATCTGCGGGGCCATCATAAGGCCTGTGGCCACCAGTGTGGCCCCTGAGACC
AAAGAATGTCCCCCGCCACCTCCCGAGACACCTGCACTTGGCTGCCTGGCTGCATGCGGC
CGGACCATCCAGCGCCACCTGGCCTTCGACATCCTGCGGCACAACACAGGCTACTGCGTG
TACATACTGGGTGTGATGTGGTCCGTCCTGGGCTTCCCACTGCCACAAGTCTTCCTGGTG
CCATATGCCATGTGGCACAGCGTGGACGAGCAGCAGGCAGCCCTCCTCATCTCCATCATC
GGCTTCAGCAACATCTTCCTGAGGCCCCTAGCCGGGCTGATGGCAGGACGGCCGGCCTTT
GCTAGCCACCGCAAGTACCTGTTCAGCCTGGCACTCCTGCTCAATGGGCTCACTAACCTG
GTGTGTGCGGCATCAGGTGACTTCTGGGTGCTCGTGGGCTACTGCCTGGCGTACAGCGTG
TCCATGAGTGGCATCGGCGCCCTCATCTTCCAGGTTCTCATGGACATCGTCCCCATGGAT
CAGTTCCCCAGAGCCCTGGGACTCTTCACTGTCCTGGACGGCCTTGCTTTCCTCATCTCC
CCACCACTGGCCGGGTTGCTCCTGGACGCCACCAACAACTTTAGCTATGTTTTCTACATG
TCCAGCTTCTTCCTCATCTCAGCTGCCCTCTTCATGGGTGGCAGCTTCTACGCCCTGCAG
AAGAAGGAGCAAGGCAAGCAGGCTGTCGCGGCGGATGCCCTGGAGCGGGATCTTTTCTTG
GAAGCCAAAGACGGTCCTGGGAAGCAACGGTCCCCTGAGATCATGTGCCAGTCTTCCCGC
CAGCCACGTCCAGCTGGCGTCAATAAGCATCTTTGGGGATGTCCTGCCTCCTCCAGGACC
AGCCATGAGTGGCTCTTATGGCCAAAGGCGGTACTGCAGGCCAAGCAAACGGCTCTGGGC
TGGAATAGCCCTACCTGA
Chromosome Location
17
Locus
17q25.1
External Identifiers
ResourceLink
UniProtKB IDO15375
UniProtKB Entry NameMOT6_HUMAN
GenBank Protein ID2463630
GenBank Gene IDU59299
GenAtlas IDSLC16A5
HGNC IDHGNC:10926
General References
  1. Price NT, Jackson VN, Halestrap AP: Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past. Biochem J. 1998 Jan 15;329 ( Pt 2):321-8. [PubMed:9425115]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00119Pyruvic acidapproved, investigational, nutraceuticalunknownDetails