RNA-dependent RNA-polymerase

Details

Name
RNA-dependent RNA-polymerase
Synonyms
Not Available
Gene Name
NS5b
Organism
Hepatitis C Virus
Amino acid sequence
>lcl|BSEQ0011720|RNA-dependent RNA-polymerase
SMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSASLRQKKVTFDRLQVL
DDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSAKSKFGYGAKDVRNLSSKAVNHIR
SVWKDLLEDTETPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVS
TLPQAVMGSSYGFQYSPGQRVEFLVNTWKSKKCPMGFSYDTRCFDSTVTENDIRVEESIY
QCCDLAPEARQAIRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKAS
AACRAAKLQDCTMLVCGDDLVVICESAGTQEDAASLRAFTEAMTRYSAPPGDPPQPEYDL
ELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMYAPTLW
ARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIQRLHGLSAFSLHSYSPG
EINRVASCLRKLGVPPLRVWRHRARSVRARLLSQGGRAATCGKYLFNWAVRTKLKLTPIP
AASQLDLSSWFVAGYSGGDIYHSLSRARPRWFMWCLLLLSVGVGIYLLPNR
Number of residues
591
Molecular Weight
65753.05
Theoretical pI
9.02
GO Classification
Functions
nucleotide binding / RNA binding / RNA-directed RNA polymerase activity
Processes
viral RNA genome replication
Components
integral component of membrane
General Function
Rna-directed rna polymerase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
571-588
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0004719|1776 bp
TCGATGTCCTACACATGGACAGGCGCCCTGATCACGCCATGCGCTGCGGAGGAATCCAAG
CTGCCCATCAATGCACTGAGCAACTCTTTGCTCCGTCACCACAACATGGTCTATGCTACA
ACATCTCGCAGCGCAAGCCTGCGGCAGAAGAAGGTCACCTTTGACAGACTGCAGGTCCTG
GACGACCACTACCGGGACGTGCTCAAGGAGATGAAGGCGAAGGCGTCCACAGTTAAGGCT
AAACTTCTATCCGTGGAGGAAGCCTGTAAGCTGACGCCCCCACATTCGGCCAAATCTAAA
TTTGGCTATGGGGCAAAGGACGTCCGGAACCTATCCAGCAAGGCCGTTAACCACATCCGC
TCCGTGTGGAAGGACTTGCTGGAAGACACTGAGACACCAATTGACACCACCATCATGGCA
AAAAATGAGGTTTTCTGCGTCCAACCAGAGAAGGGGGGCCGCAAGCCAGCTCGCCTTATC
GTATTCCCAGATTTGGGGGTTCGTGTGTGCGAGAAAATGGCCCTTTACGATGTGGTCTCC
ACCCTCCCTCAGGCCGTGATGGGCTCTTCATACGGATTCCAGTACTCTCCTGGACAGCGG
GTCGAGTTCCTGGTGAATACCTGGAAATCGAAAAAATGCCCTATGGGCTTCTCATATGAC
ACCCGCTGCTTTGACTCAACGGTCACTGAGAATGACATCCGTGTTGAGGAGTCAATCTAC
CAATGTTGTGACTTGGCCCCCGAAGCCAGACAGGCCATAAGGTCGCTCACAGAGCGGCTT
TACATCGGGGGCCCCCTGACTAATTCAAAGGGGCAGAACTGCGGCTATCGCCGGTGCCGC
GCGAGCGGTGTACTGACGACCAGCTGCGGTAATACCCTCACATGTTACTTGAAGGCCTCT
GCGGCCTGTCGAGCTGCGAAGCTCCAGGACTGCACGATGCTCGTGTGCGGAGACGACCTT
GTCGTTATCTGTGAAAGCGCGGGGACCCAAGAGGACGCGGCGAGCCTACGAGCCTTCACG
GAGGCTATGACTAGATACTCTGCCCCCCCTGGGGACCCGCCCCAACCAGAATACGACTTG
GAGTTGATAACATCATGCTCCTCCAATGTGTCTGTCGCGCACGATGCATCTGGCAAAAGG
GTGTACTATCTCACCCGTGACCCCACCACCCCCCTTGCGCGGGCTGCGTGGGAGACAGCT
AGACACACTCCAGTCAATTCCTGGCTAGGCAACATCATCATGTATGCGCCCACCTTGTGG
GCAAGGATGATCCTGATGACTCATTTCTTCTCCATCCTTCTAGCTCAGGAACAACTTGAA
AAAGCCCTAGATTGTCAGATCTACGGGGCCTGTTACTCCATTGAGCCACTTGACCTACCT
CAGATCATTCAACGACTCCATGGCCTTAGCGCATTTTCACTCCATAGTTACTCTCCAGGT
GAGATCAATAGGGTGGCTTCATGCCTCAGGAAACTTGGGGTACCGCCCTTGCGAGTCTGG
AGACATCGGGCCAGAAGTGTCCGCGCTAGGCTACTGTCCCAGGGGGGGAGGGCTGCCACT
TGTGGCAAGTACCTCTTCAACTGGGCAGTAAGGACCAAGCTCAAACTCACTCCAATCCCG
GCTGCGTCCCAGTTGGATTTATCCAGCTGGTTCGTTGCTGGTTACAGCGGGGGAGACATA
TATCACAGCCTGTCTCGTGCCCGACCCCGCTGGTTCATGTGGTGCCTACTCCTACTTTCT
GTAGGGGTAGGCATCTACCTGCTCCCCAACCGGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO39930
UniProtKB Entry NameO39930_9HEPC
GenBank Gene IDZ97730
General References
  1. Lohmann V, Korner F, Herian U, Bartenschlager R: Biochemical properties of hepatitis C virus NS5B RNA-dependent RNA polymerase and identification of amino acid sequence motifs essential for enzymatic activity. J Virol. 1997 Nov;71(11):8416-28. [PubMed:9343198]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05060R1626investigationalunknownDetails
DB07199(2S,4S,5R)-1-(4-TERT-BUTYLBENZOYL)-2-ISOBUTYL-5-(1,3-THIAZOL-2-YL)PYRROLIDINE-2,4-DICARBOXYLIC ACIDexperimentalunknownDetails
DB07200(2S,4S,5R)-2-ISOBUTYL-5-(2-THIENYL)-1-[4-(TRIFLUOROMETHYL)BENZOYL]PYRROLIDINE-2,4-DICARBOXYLIC ACIDexperimentalunknownDetails
DB08934SofosbuvirapprovedyesinhibitorDetails