ATPase ASNA1

Details

Name
ATPase ASNA1
Synonyms
  • 3.6.-.-
  • ARSA
  • Arsenical pump-driving ATPase
  • Arsenite-stimulated ATPase
  • hARSA-I
  • hASNA-I
  • Transmembrane domain recognition complex 40 kDa ATPase subunit
  • TRC40
Gene Name
ASNA1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001496|ATPase ASNA1
MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQ
LSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFE
EDNMLSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFP
TIVERGLGRLMQIKNQISPFISQMCNMLGLGDMNADQLASKLEETLPVIRSVSEQFKDPE
QTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEKPCKMCEARHKIQA
KYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ
Number of residues
348
Molecular Weight
38792.445
Theoretical pI
4.54
GO Classification
Functions
arsenite transmembrane transporter activity / ATP binding / ATPase activity / metal ion binding / transporter activity
Processes
cellular protein metabolic process / endoplasmic reticulum unfolded protein response / inorganic anion transport / IRE1-mediated unfolded protein response / protein insertion into ER membrane / transport
Components
cytoplasm / endoplasmic reticulum membrane / extracellular exosome / nucleolus / nucleus
General Function
Transporter activity
Specific Function
ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting (By similarity). May be involved in insulin signaling.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010528|ATPase ASNA1 (ASNA1)
ATGGCGGCAGGGGTGGCCGGGTGGGGGGTTGAGGCAGAGGAGTTCGAAGATGCTCCTGAT
GTGGAGCCGCTGGAGCCTACACTTAGCAACATCATCGAGCAGCGCAGCCTGAAGTGGATC
TTCGTCGGGGGCAAGGGTGGTGTGGGCAAGACCACCTGCAGCTGCAGCCTGGCAGTCCAG
CTCTCCAAGGGGCGTGAGAGTGTTCTGATCATCTCCACAGACCCAGCACACAACATCTCA
GATGCTTTTGACCAGAAGTTCTCAAAGGTGCCTACCAAGGTCAAAGGCTATGACAACCTC
TTTGCTATGGAGATTGACCCCAGCCTGGGCGTGGCGGAGCTGCCTGACGAGTTCTTCGAG
GAGGACAACATGCTGAGCATGGGCAAGAAGATGATGCAGGAGGCCATGAGCGCATTTCCC
GGCATCGATGAGGCCATGAGCTATGCCGAGGTCATGAGGCTGGTGAAGGGCATGAACTTC
TCGGTGGTGGTATTTGACACGGCACCCACGGGCCACACCCTGAGGCTGCTCAACTTCCCC
ACCATCGTGGAGCGGGGCCTGGGCCGGCTTATGCAGATCAAGAACCAGATCAGCCCTTTC
ATCTCACAGATGTGCAACATGCTGGGCCTGGGGGACATGAACGCAGACCAGCTGGCCTCC
AAGCTGGAGGAGACGCTGCCCGTCATCCGCTCAGTCAGCGAACAGTTCAAGGACCCTGAG
CAGACAACTTTCATCTGCGTATGCATTGCTGAGTTCCTGTCCCTGTATGAGACAGAGAGG
CTGATCCAGGAGCTGGCCAAGTGCAAGATTGACACACACAATATAATTGTCAACCAGCTC
GTCTTCCCCGACCCCGAGAAGCCCTGCAAGATGTGTGAGGCCCGTCACAAGATCCAGGCC
AAGTATCTGGACCAGATGGAGGACCTGTATGAAGACTTCCACATCGTGAAGCTGCCGCTG
TTACCCCATGAGGTGCGGGGGGCAGACAAGGTCAACACCTTCTCGGCCCTCCTCCTGGAG
CCCTACAAGCCCCCCAGTGCCCAGTAG
Chromosome Location
19
Locus
19q13.3
External Identifiers
ResourceLink
UniProtKB IDO43681
UniProtKB Entry NameASNA_HUMAN
GenBank Protein ID2905657
GenBank Gene IDAF047469
GenAtlas IDASNA1
HGNC IDHGNC:752
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Kurdi-Haidar B, Aebi S, Heath D, Enns RE, Naredi P, Hom DK, Howell SB: Isolation of the ATP-binding human homolog of the arsA component of the bacterial arsenite transporter. Genomics. 1996 Sep 15;36(3):486-91. [PubMed:8884272]
  5. Kurdi-Haidar B, Heath D, Aebi S, Howell SB: Biochemical characterization of the human arsenite-stimulated ATPase (hASNA-I). J Biol Chem. 1998 Aug 28;273(35):22173-6. [PubMed:9712828]
  6. Kurdi-Haidar B, Hom DK, Flittner DE, Heath D, Fink L, Naredi P, Howell SB: Dual cytoplasmic and nuclear distribution of the novel arsenite-stimulated human ATPase (hASNA-I). J Cell Biochem. 1998 Oct 1;71(1):1-10. [PubMed:9736449]
  7. Kurdi-Haidar B, Heath D, Naredi P, Varki N, Howell SB: Immunohistochemical analysis of the distribution of the human ATPase (hASNA-I) in normal tissues and its overexpression in breast adenomas and carcinomas. J Histochem Cytochem. 1998 Nov;46(11):1243-8. [PubMed:9774623]
  8. Stefanovic S, Hegde RS: Identification of a targeting factor for posttranslational membrane protein insertion into the ER. Cell. 2007 Mar 23;128(6):1147-59. [PubMed:17382883]
  9. Favaloro V, Spasic M, Schwappach B, Dobberstein B: Distinct targeting pathways for the membrane insertion of tail-anchored (TA) proteins. J Cell Sci. 2008 Jun 1;121(11):1832-40. doi: 10.1242/jcs.020321. Epub 2008 May 13. [PubMed:18477612]
  10. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  11. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  12. Vilardi F, Lorenz H, Dobberstein B: WRB is the receptor for TRC40/Asna1-mediated insertion of tail-anchored proteins into the ER membrane. J Cell Sci. 2011 Apr 15;124(Pt 8):1301-7. doi: 10.1242/jcs.084277. [PubMed:21444755]
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00171ATPinvestigational, nutraceuticalunknownDetails