Cytohesin-3

Details

Name
Cytohesin-3
Synonyms
  • ARF nucleotide-binding site opener 3
  • ARNO3
  • General receptor of phosphoinositides 1
  • GRP1
  • PH, SEC7 and coiled-coil domain-containing protein 3
  • Protein ARNO3
  • PSCD3
Gene Name
CYTH3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009354|Cytohesin-3
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYT
TDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYR
ISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Number of residues
400
Molecular Weight
46348.235
Theoretical pI
Not Available
GO Classification
Functions
ARF guanyl-nucleotide exchange factor activity / phosphatidylinositol-3,4,5-trisphosphate binding
Processes
establishment of epithelial cell polarity / Golgi vesicle transport / positive regulation of cell adhesion / positive regulation of GTPase activity / regulation of ARF protein signal transduction / regulation of cell adhesion
Components
cytosol / extrinsic component of cytoplasmic side of plasma membrane / plasma membrane / ruffle
General Function
Phosphatidylinositol-3,4,5-trisphosphate binding
Specific Function
Promotes guanine-nucleotide exchange on ARF1 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0020756|Cytohesin-3 (CYTH3)
ATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAGACCTCTCATTAGAAGAG
AGAGAAGAACTTCTAGACATTCGTCGAAGAAAAAAGGAACTTATTGATGACATTGAGAGG
CTGAAATATGAAATTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAG
AGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAAAGAAATTCAACATGGAT
CCCAAAAAGGGAATTCAGTTTCTAATAGAAAATGACCTGCTACAGAGTTCCCCAGAAGAC
GTCGCCCAGTTCCTTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTG
GGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTGTTGAACTCCATGAGTTT
GCTGATCTCAACCTTGTACAAGCCTTAAGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGG
GAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAAC
CCCGGGGTCTTCCAGTCCACAGACACGTGCTACGTGCTGTCATTCGCCATCATCATGCTC
AACACCAGCCTCCACAACCACAACGTGCGTGACAAGCCCACGGCAGAACGGTTCATCGCC
ATGAACCGCGGCATCAACGAGGGCGGGGACCTCCCTGAGGAGCTGCTGAGGAATTTGTAT
GAGAGCATTAAGAACGAGCCATTTAAGATCCCGGAGGACGACGGGAACGACCTGACCCAC
ACCTTCTTCAACCCCGACCGCGAGGGCTGGCTCCTGAAGCTGGGAGGGCGTGTGAAGACC
TGGAAGCGCCGGTGGTTCATCCTGACCGATAACTGCCTCTATTACTTTGAATACACAACA
GATAAGGAGCCCAGGGGAATCATCCCGTTGGAAAACCTCAGCATCAGGGAGGTGGAGGAC
CCCCGGAAACCCAACTGTTTTGAGCTCTACAATCCCAGCCACAAAGGGCAGGTCATCAAG
GCCTGTAAGACTGAGGCCGACGGCCGCGTGGTAGAGGGGAACCATGTGGTGTACCGGATC
TCAGCCCCGAGCCCGGAGGAGAAGGAGGAGTGGATGAAATCCATCAAAGCCAGTATCAGC
AGAGATCCCTTCTATGACATGTTGGCAACGAGGAAACGAAGGATTGCCAATAAAAAATAG
Chromosome Location
7
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO43739
UniProtKB Entry NameCYH3_HUMAN
HGNC IDHGNC:9504
General References
  1. Venkateswarlu K, Gunn-Moore F, Oatey PB, Tavare JM, Cullen PJ: Nerve growth factor- and epidermal growth factor-stimulated translocation of the ADP-ribosylation factor-exchange factor GRP1 to the plasma membrane of PC12 cells requires activation of phosphatidylinositol 3-kinase and the GRP1 pleckstrin homology domain. Biochem J. 1998 Oct 1;335 ( Pt 1):139-46. [PubMed:9742223]
  2. Franco M, Boretto J, Robineau S, Monier S, Goud B, Chardin P, Chavrier P: ARNO3, a Sec7-domain guanine nucleotide exchange factor for ADP ribosylation factor 1, is involved in the control of Golgi structure and function. Proc Natl Acad Sci U S A. 1998 Aug 18;95(17):9926-31. [PubMed:9707577]
  3. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Ogasawara M, Kim SC, Adamik R, Togawa A, Ferrans VJ, Takeda K, Kirby M, Moss J, Vaughan M: Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors. J Biol Chem. 2000 Feb 4;275(5):3221-30. [PubMed:10652308]
  6. Hofmann I, Thompson A, Sanderson CM, Munro S: The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane. Curr Biol. 2007 Apr 17;17(8):711-6. Epub 2007 Mar 29. [PubMed:17398095]
  7. Malaby AW, van den Berg B, Lambright DG: Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors. Proc Natl Acad Sci U S A. 2013 Aug 27;110(35):14213-8. doi: 10.1073/pnas.1301883110. Epub 2013 Aug 12. [PubMed:23940353]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03344Inositol-(1,3,4,5,6)-PentakisphosphateexperimentalunknownDetails
DB01863Inositol 1,3,4,5-TetrakisphosphateexperimentalunknownDetails