UDP-glucose 6-dehydrogenase

Details

Name
UDP-glucose 6-dehydrogenase
Synonyms
  • 1.1.1.22
  • UDP-Glc dehydrogenase
Gene Name
UGDH
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001286|UDP-glucose 6-dehydrogenase
MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEV
VESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNS
NGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLI
GGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISAL
CEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYW
QQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDE
GAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF
KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIP
KFSLQDPPNKKPKV
Number of residues
494
Molecular Weight
55023.545
Theoretical pI
7.13
GO Classification
Functions
electron carrier activity / NAD binding / UDP-glucose 6-dehydrogenase activity
Processes
carbohydrate metabolic process / cellular glucuronidation / gastrulation with mouth forming second / glycosaminoglycan biosynthetic process / small molecule metabolic process / UDP-glucose metabolic process / UDP-glucuronate biosynthetic process / xenobiotic metabolic process
Components
cytosol / extracellular exosome / nucleoplasm
General Function
Udp-glucose 6-dehydrogenase activity
Specific Function
Involved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0018990|UDP-glucose 6-dehydrogenase (UGDH)
ATGTTTGAAATTAAGAAGATCTGTTGCATCGGTGCAGGCTATGTTGGAGGACCCACATGT
AGTGTCATTGCTCATATGTGTCCTGAAATCAGGGTAACGGTTGTTGATGTCAATGAATCA
AGAATCAATGCGTGGAATTCTCCTACACTTCCTATTTATGAGCCAGGACTAAAAGAAGTG
GTAGAATCCTGTCGAGGAAAAAATCTTTTTTTTTCTACCAATATTGATGATGCCATCAAA
GAAGCTGATCTTGTATTTATTTCTGTGCTGTCCAACCCTGAGTTTCTGGCAGAGGGAACA
GCCATCAAGGACCTAAAGAACCCAGACAGAGTACTGATTGGAGGGGATGAAACTCCAGAG
GGCCAGAGAGCTGTGCAGGCCCTGTGTGCTGTATATGAGCACTGGGTTCCCAGAGAAAAG
ATCCTCACCACTAATACTTGGTCTTCAGAGCTTTCCAAACTGGCAGCAAATGCTTTTCTT
GCCCAGAGAATAAGCAGCATTAACTCCATAAGTGCTCTGTGTGAAGCAACAGGAGCTGAT
GTAGAAGAGGTAGCAACAGCGATTGGAATGGACCAGAGAATTGGAAACAAGTTTCTAAAA
GCCAGTGTTGGGTTTGGTGGGAGCTGTTTCCAAAAGGATGTTCTGAATTTGGTTTATCTC
TGTGAGGCTCTGAATTTGCCAGAAGTAGCTCGTTATTGGCAGCAGGTCATAGACATGAAT
GACTACCAGAGGAGGAGGTTTGCTTCCCGGATCATAGATAGTCTGTTTAATACAGTAACT
GATAAGAAGATAGCTATTTTGGGATTTGCATTCAAAAAGGACACTGGTGATACAAGAGAA
TCTTCTAGTATATATATTAGCAAATATTTGATGGATGAAGGTGCACATCTACATATATAT
GATCCAAAAGTACCTAGGGAACAAATAGTTGTGGATCTTTCTCATCCAGGTGTTTCAGAG
GATGACCAAGTGTCCCGGCTCGTGACCATTTCCAAGGATCCATATGAAGCATGTGATGGT
GCCCATGCTGTTGTTATTTGCACTGAGTGGGACATGTTTAAGGAATTGGATTATGAACGC
ATTCATAAAAAAATGCTAAAGCCAGCCTTTATCTTCGATGGACGGCGTGTCCTGGATGGG
CTCCACAATGAACTACAAACCATTGGCTTCCAGATTGAAACAATTGGCAAAAAGGTGTCT
TCAAAGAGAATTCCATATGCTCCTTCTGGTGAAATTCCGAAGTTTAGTCTTCAAGATCCA
CCTAACAAGAAACCTAAAGTGTAG
Chromosome Location
4
Locus
4p15.1
External Identifiers
ResourceLink
UniProtKB IDO60701
UniProtKB Entry NameUGDH_HUMAN
GenBank Protein ID3127127
GenBank Gene IDAF061016
GenAtlas IDUGDH
HGNC IDHGNC:12525
General References
  1. Spicer AP, Kaback LA, Smith TJ, Seldin MF: Molecular cloning and characterization of the human and mouse UDP-glucose dehydrogenase genes. J Biol Chem. 1998 Sep 25;273(39):25117-24. [PubMed:9737970]
  2. Peng HL, Lou MD, Chang ML, Chang HY: cDNA cloning and expression analysis of the human UDPglucose dehydrogenase. Proc Natl Sci Counc Repub China B. 1998 Oct;22(4):166-72. [PubMed:9850599]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861]
  7. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  8. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  10. Egger S, Chaikuad A, Klimacek M, Kavanagh KL, Oppermann U, Nidetzky B: Structural and kinetic evidence that catalytic reaction of human UDP-glucose 6-dehydrogenase involves covalent thiohemiacetal and thioester enzyme intermediates. J Biol Chem. 2012 Jan 13;287(3):2119-29. doi: 10.1074/jbc.M111.313015. Epub 2011 Nov 28. [PubMed:22123821]
  11. Sennett NC, Kadirvelraj R, Wood ZA: Conformational flexibility in the allosteric regulation of human UDP-alpha-D-glucose 6-dehydrogenase. Biochemistry. 2011 Nov 8;50(44):9651-63. doi: 10.1021/bi201381e. Epub 2011 Oct 13. [PubMed:21961565]
  12. Egger S, Chaikuad A, Kavanagh KL, Oppermann U, Nidetzky B: Structure and mechanism of human UDP-glucose 6-dehydrogenase. J Biol Chem. 2011 Jul 8;286(27):23877-87. doi: 10.1074/jbc.M111.234682. Epub 2011 Apr 18. [PubMed:21502315]
  13. Rajakannan V, Lee HS, Chong SH, Ryu HB, Bae JY, Whang EY, Huh JW, Cho SW, Kang LW, Choe H, Robinson RC: Structural basis of cooperativity in human UDP-glucose dehydrogenase. PLoS One. 2011;6(10):e25226. doi: 10.1371/journal.pone.0025226. Epub 2011 Oct 3. [PubMed:21984906]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00157NADHapproved, nutraceuticalunknownDetails
DB09130Copperapproved, investigationalunknownDetails