Hyaluronan mediated motility receptor

Details

Name
Hyaluronan mediated motility receptor
Synonyms
  • IHABP
  • Intracellular hyaluronic acid-binding protein
  • Receptor for hyaluronan-mediated motility
  • RHAMM
Gene Name
HMMR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008553|Hyaluronan mediated motility receptor
MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDT
TLPASARKVKSSESKESQKNDKDLKILEKEIRVLLQERGAQDRRIQDLETELEKMEARLN
AALREKTSLSANNATLEKQLIELTRTNELLKSKFSENGNQKNLRILSLELMKLRNKRETK
MRGMMAKQEGMEMKLQVTQRSLEESQGKIAQLEGKLVSIEKEKIDEKSETEKLLEYIEEI
SCASDQVEKYKLDIAQLEENLKEKNDEILSLKQSLEENIVILSKQVEDLNVKCQLLEKEK
EDHVNRNREHNENLNAEMQNLKQKFILEQQEREKLQQKELQIDSLLQQEKELSSSLHQKL
CSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKL
KGKEAELEKSSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSL
QEKAAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKETEIKEITVSFLQKITDL
QNQLKQQEEDFRKQLEDEEGRKAEKENTTAELTEEINKWRLLYEELYNKTKPFQLQLDAF
EVEKQALLNEHGAAQEQLNKIRDSYAKLLGHQNLKQKIKHVVKLKDENSQLKSEVSKLRC
QLAKKKQSETKLQEELNKVLGIKHFDPSKAFHHESKENFALKTPLKEGNTNCYRAPMECQ
ESWK
Number of residues
724
Molecular Weight
84099.845
Theoretical pI
Not Available
GO Classification
Functions
hyaluronic acid binding
Processes
carbohydrate metabolic process / glycosaminoglycan metabolic process / hyaluronan catabolic process / hyaluronan metabolic process / small molecule metabolic process
Components
cell surface / cytoplasm / membrane / plasma membrane
General Function
Hyaluronic acid binding
Specific Function
Involved in cell motility. When hyaluronan binds to HMMR, the phosphorylation of a number of proteins, including PTK2/FAK1 occurs. May also be involved in cellular transformation and metastasis formation, and in regulating extracellular-regulated kinase (ERK) activity.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell surface
Gene sequence
>lcl|BSEQ0013269|Hyaluronan mediated motility receptor (HMMR)
ATGTCCTTTCCTAAGGCGCCCTTGAAACGATTCAATGACCCTTCTGGTTGTGCACCATCT
CCAGGTGCTTATGATGTTAAAACTTTAGAAGTATTGAAAGGACCAGTATCCTTTCAGAAA
TCACAAAGATTTAAACAACAAAAAGAATCTAAACAAAATCTTAATGTTGACAAAGATACT
ACCTTGCCTGCTTCAGCTAGAAAAGTTAAGTCTTCGGAATCAAAGAAGGAATCTCAAAAG
AATGATAAAGATTTGAAGATATTAGAGAAAGAGATTCGTGTTCTTCTACAGGAACGTGGT
GCCCAGGACAGGCGGATCCAGGATCTGGAAACTGAGTTGGAAAAGATGGAAGCAAGGCTA
AATGCTGCACTAAGGGAAAAAACATCTCTCTCTGCAAATAATGCTACACTGGAAAAACAA
CTTATTGAATTGACCAGGACTAATGAACTACTAAAATCTAAGTTTTCTGAAAATGGTAAC
CAGAAGAATTTGAGAATTCTAAGCTTGGAGTTGATGAAACTTAGAAACAAAAGAGAAACA
AAGATGAGGGGTATGATGGCTAAGCAAGAAGGCATGGAGATGAAGCTGCAGGTCACCCAA
AGGAGTCTCGAAGAGTCTCAAGGGAAAATAGCCCAACTGGAGGGAAAACTTGTTTCAATA
GAGAAAGAAAAGATTGATGAAAAATCTGAAACAGAAAAACTCTTGGAATACATCGAAGAA
ATTAGTTGTGCTTCAGATCAAGTGGAAAAATACAAGCTAGATATTGCCCAGTTAGAAGAA
AATTTGAAAGAGAAGAATGATGAAATTTTAAGCCTTAAGCAGTCTCTTGAGGAGAATATT
GTTATATTATCTAAACAAGTAGAAGATCTAAATGTGAAATGTCAGCTGCTTGAAAAAGAA
AAAGAAGACCATGTCAACAGGAATAGAGAACACAACGAAAATCTAAATGCAGAGATGCAA
AACTTAAAACAGAAGTTTATTCTTGAACAACAGGAACGTGAAAAGCTTCAACAAAAAGAA
TTACAAATTGATTCACTTCTGCAACAAGAGAAAGAATTATCTTCGAGTCTTCATCAGAAG
CTCTGTTCTTTTCAAGAGGAAATGGTTAAAGAGAAGAATCTGTTTGAGGAAGAATTAAAG
CAAACACTGGATGAGCTTGATAAATTACAGCAAAAGGAGGAACAAGCTGAAAGGCTGGTC
AAGCAATTGGAAGAGGAAGCAAAATCTAGAGCTGAAGAATTAAAACTCCTAGAAGAAAAG
CTGAAAGGGAAGGAGGCTGAACTGGAGAAAAGTAGTGCTGCTCATACCCAGGCCACCCTG
CTTTTGCAGGAAAAGTATGACAGTATGGTGCAAAGCCTTGAAGATGTTACTGCTCAATTT
GAAAGCTATAAAGCGTTAACAGCCAGTGAGATAGAAGATCTTAAGCTGGAGAACTCATCA
TTACAGGAAAAAGCGGCCAAGGCTGGGAAAAATGCAGAGGATGTTCAGCATCAGATTTTG
GCAACTGAGAGCTCAAATCAAGAATATGTAAGGATGCTTCTAGATCTGCAGACCAAGTCA
GCACTAAAGGAAACAGAAATTAAAGAAATCACAGTTTCTTTTCTTCAAAAAATAACTGAT
TTGCAGAACCAACTCAAGCAACAGGAGGAAGACTTTAGAAAACAGCTGGAAGATGAAGAA
GGAAGAAAAGCTGAAAAAGAAAATACAACAGCAGAATTAACTGAAGAAATTAACAAGTGG
CGTCTCCTCTATGAAGAACTATATAATAAAACAAAACCTTTTCAGCTACAACTAGATGCT
TTTGAAGTAGAAAAACAGGCATTGTTGAATGAACATGGTGCAGCTCAGGAACAGCTAAAT
AAAATAAGAGATTCATATGCTAAATTATTGGGTCATCAGAATTTGAAACAAAAAATCAAG
CATGTTGTGAAGTTGAAAGATGAAAATAGCCAACTCAAATCGGAAGTATCAAAACTCCGC
TGTCAGCTTGCTAAAAAAAAACAAAGTGAGACAAAACTTCAAGAGGAATTGAATAAAGTT
CTAGGTATCAAACACTTTGATCCTTCAAAGGCTTTTCATCATGAAAGTAAAGAAAATTTT
GCCCTGAAGACCCCATTAAAAGAAGGCAATACAAACTGTTACCGAGCTCCTATGGAGTGT
CAAGAATCATGGAAGTAA
Chromosome Location
5
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO75330
UniProtKB Entry NameHMMR_HUMAN
HGNC IDHGNC:5012
General References
  1. Wang C, Entwistle J, Hou G, Li Q, Turley EA: The characterization of a human RHAMM cDNA: conservation of the hyaluronan-binding domains. Gene. 1996 Oct 3;174(2):299-306. [PubMed:8890751]
  2. Assmann V, Marshall JF, Fieber C, Hofmann M, Hart IR: The human hyaluronan receptor RHAMM is expressed as an intracellular protein in breast cancer cells. J Cell Sci. 1998 Jun;111 ( Pt 12):1685-94. [PubMed:9601098]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08818Hyaluronic acidapproved, vet_approvedyesDetails