Transient receptor potential cation channel subfamily A member 1

Details

Name
Transient receptor potential cation channel subfamily A member 1
Synonyms
  • ANKTM1
  • Ankyrin-like with transmembrane domains protein 1
  • Transformation-sensitive protein p120
Gene Name
TRPA1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016320|Transient receptor potential cation channel subfamily A member 1
MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCD
DMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSR
GANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEA
LQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKA
TPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNL
LLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDL
HGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKC
TDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNF
KYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHM
MNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLS
SIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLA
VGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIF
CFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETED
DDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
Number of residues
1119
Molecular Weight
127499.88
Theoretical pI
6.98
GO Classification
Functions
channel activity / intracellular ligand-gated calcium channel activity / temperature-gated cation channel activity
Processes
calcium ion transmembrane transport / cell surface receptor signaling pathway / detection of chemical stimulus involved in sensory perception of pain / detection of mechanical stimulus involved in sensory perception of pain / ion transmembrane transport / ion transport / protein homotetramerization / response to cold / response to drug / response to hydrogen peroxide / response to organic cyclic compound / response to organic substance / response to pain / sensory perception of pain / thermoception / transmembrane transport
Components
integral component of plasma membrane / plasma membrane / stereocilium bundle
General Function
Temperature-gated cation channel activity
Specific Function
Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function (PubMed:25389312, PubMed:25855297). Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, cinnamaldehyde, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes (PubMed:25389312, PubMed:20547126). Is also activated by menthol (in vitro)(PubMed:25389312). Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana (PubMed:25389312). May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system (By similarity).
Pfam Domain Function
Transmembrane Regions
720-740 765-785 804-824 830-850 874-894 935-956
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016321|Transient receptor potential cation channel subfamily A member 1 (TRPA1)
ATGAAGCGCAGCCTGAGGAAGATGTGGCGCCCTGGAGAAAAGAAGGAGCCCCAGGGCGTT
GTCTATGAGGATGTGCCGGACGACACGGAGGATTTCAAGGAATCGCTTAAGGTGGTTTTT
GAAGGAAGTGCATATGGATTACAAAACTTTAATAAGCAAAAGAAATTAAAAAGATGTGAC
GATATGGACACCTTCTTCTTGCATTATGCTGCAGCAGAAGGCCAAATTGAGCTAATGGAG
AAGATCACCAGAGATTCCTCTTTGGAAGTGCTGCATGAAATGGATGATTATGGAAATACC
CCTCTGCATTGTGCTGTAGAAAAAAACCAAATTGAAAGCGTTAAGTTTCTTCTCAGCAGA
GGAGCAAACCCAAATCTCCGAAACTTCAACATGATGGCTCCTCTCCACATAGCTGTGCAG
GGCATGAATAATGAGGTGATGAAGGTCTTGCTTGAGCATAGAACTATTGATGTTAATTTG
GAAGGAGAAAATGGAAACACAGCTGTGATCATTGCGTGCACCACAAATAATAGCGAAGCA
TTGCAGATTTTGCTTAAAAAAGGAGCTAAGCCATGTAAATCAAATAAATGGGGATGTTTC
CCTATTCACCAAGCTGCATTTTCAGGTTCCAAAGAATGCATGGAAATAATACTAAGGTTT
GGTGAAGAGCATGGGTACAGTAGACAGTTGCACATTAACTTTATGAATAATGGGAAAGCC
ACCCCTCTCCACCTGGCTGTGCAAAATGGTGACTTGGAAATGATCAAAATGTGCCTGGAC
AATGGTGCACAAATAGACCCAGTGGAGAAGGGAAGGTGCACAGCCATTCATTTTGCTGCC
ACCCAGGGAGCCACTGAGATTGTTAAACTGATGATATCGTCCTATTCTGGTAGCGTGGAT
ATTGTTAACACAACCGATGGATGTCATGAGACCATGCTTCACAGAGCTTCATTGTTTGAT
CACCATGAGCTAGCAGACTATTTAATTTCAGTGGGAGCAGATATTAATAAGATCGATTCT
GAAGGACGCTCTCCACTTATATTAGCAACTGCTTCTGCATCTTGGAATATTGTAAATTTG
CTACTCTCTAAAGGTGCCCAAGTAGACATAAAAGATAATTTTGGACGTAATTTTCTGCAT
TTAACTGTACAGCAACCTTATGGATTAAAAAATCTGCGACCTGAATTTATGCAGATGCAA
CAGATCAAAGAGCTGGTAATGGATGAAGACAACGATGGGTGTACTCCTCTACATTATGCA
TGTAGACAGGGGGGCCCTGGTTCTGTAAATAACCTACTTGGCTTTAATGTGTCCATTCAT
TCCAAAAGCAAAGATAAGAAATCACCTCTGCATTTTGCAGCCAGTTATGGGCGTATCAAT
ACCTGTCAGAGGCTCCTACAAGACATAAGTGATACGAGGCTTCTGAATGAAGGTGACCTT
CATGGAATGACTCCTCTCCATCTGGCAGCAAAGAATGGACATGATAAAGTAGTTCAGCTT
CTTCTGAAAAAAGGTGCATTGTTTCTCAGTGACCACAATGGCTGGACAGCTTTGCATCAT
GCGTCCATGGGCGGGTACACTCAGACCATGAAGGTCATTCTTGATACTAATTTGAAGTGC
ACAGATCGCCTGGATGAAGACGGGAACACTGCACTTCACTTTGCTGCAAGGGAAGGCCAC
GCCAAAGCCGTTGCGCTTCTTCTGAGCCACAATGCTGACATAGTCCTGAACAAGCAGCAG
GCCTCCTTTTTGCACCTTGCACTTCACAATAAGAGGAAGGAGGTTGTTCTTACGATCATC
AGGAGCAAAAGATGGGATGAATGTCTTAAGATTTTCAGTCATAATTCTCCAGGCAATAAA
TGTCCAATTACAGAAATGATAGAATACCTCCCTGAATGCATGAAGGTACTTTTAGATTTC
TGCATGTTGCATTCCACAGAAGACAAGTCCTGCCGAGACTATTATATCGAGTATAATTTC
AAATATCTTCAATGTCCATTAGAATTCACCAAAAAAACACCTACACAGGATGTTATATAT
GAACCGCTTACAGCCCTCAACGCAATGGTACAAAATAACCGCATAGAGCTTCTCAATCAT
CCTGTGTGTAAAGAATATTTACTCATGAAATGGTTGGCTTATGGATTTAGAGCTCATATG
ATGAATTTAGGATCTTACTGTCTTGGTCTCATACCTATGACCATTCTCGTTGTCAATATA
AAACCAGGAATGGCTTTCAACTCAACTGGCATCATCAATGAAACTAGTGATCATTCAGAA
ATACTAGATACCACGAATTCATATCTAATAAAAACTTGTATGATTTTAGTGTTTTTATCA
AGTATATTTGGGTATTGCAAAGAAGCGGGGCAAATTTTCCAACAGAAAAGGAATTATTTT
ATGGATATAAGCAATGTTCTTGAATGGATTATCTACACGACGGGCATCATTTTTGTGCTG
CCCTTGTTTGTTGAAATACCAGCTCATCTGCAGTGGCAATGTGGAGCAATTGCTGTTTAC
TTCTATTGGATGAATTTCTTATTGTATCTTCAAAGATTTGAAAATTGTGGAATTTTTATT
GTTATGTTGGAGGTAATTTTGAAAACTTTGTTGAGGTCTACAGTTGTATTTATCTTCCTT
CTTCTGGCTTTTGGACTCAGCTTTTACATCCTCCTGAATTTACAGGATCCCTTCAGCTCT
CCATTGCTTTCTATAATCCAGACCTTCAGCATGATGCTAGGAGATATCAATTATCGAGAG
TCCTTCCTAGAACCATATCTGAGAAATGAATTGGCACATCCAGTTCTGTCCTTTGCACAA
CTTGTTTCCTTCACAATATTTGTCCCAATTGTCCTCATGAATTTACTTATTGGTTTGGCA
GTTGGCGACATTGCTGAGGTCCAGAAACATGCATCATTGAAGAGGATAGCTATGCAGGTG
GAACTTCATACCAGCTTAGAGAAGAAGCTGCCACTTTGGTTTCTACGCAAAGTGGATCAG
AAATCCACCATCGTGTATCCCAACAAACCCAGATCTGGTGGGATGTTATTCCATATATTC
TGTTTTTTATTTTGCACTGGGGAAATAAGACAAGAAATACCAAATGCTGATAAATCTTTA
GAAATGGAAATATTAAAGCAGAAATACCGGCTGAAGGATCTTACTTTTCTCCTGGAAAAA
CAGCATGAGCTCATTAAACTGATCATTCAGAAGATGGAGATCATCTCTGAGACAGAGGAT
GATGATAGCCATTGTTCTTTTCAAGACAGGTTTAAGAAAGAGCAGATGGAACAAAGGAAT
AGCAGATGGAATACTGTGTTGAGAGCAGTCAAGGCAAAAACACACCATCTTGAGCCTTAG
Chromosome Location
8
Locus
8q13
External Identifiers
ResourceLink
UniProtKB IDO75762
UniProtKB Entry NameTRPA1_HUMAN
GenBank Protein ID3287188
GenBank Gene IDY10601
GenAtlas IDTRPA1
HGNC IDHGNC:497
General References
  1. Jaquemar D, Schenker T, Trueb B: An ankyrin-like protein with transmembrane domains is specifically lost after oncogenic transformation of human fibroblasts. J Biol Chem. 1999 Mar 12;274(11):7325-33. [PubMed:10066796]
  2. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571]
  3. Moparthi L, Survery S, Kreir M, Simonsen C, Kjellbom P, Hogestatt ED, Johanson U, Zygmunt PM: Human TRPA1 is intrinsically cold- and chemosensitive with and without its N-terminal ankyrin repeat domain. Proc Natl Acad Sci U S A. 2014 Nov 25;111(47):16901-6. doi: 10.1073/pnas.1412689111. Epub 2014 Nov 11. [PubMed:25389312]
  4. Paulsen CE, Armache JP, Gao Y, Cheng Y, Julius D: Structure of the TRPA1 ion channel suggests regulatory mechanisms. Nature. 2015 Apr 23;520(7548):511-7. doi: 10.1038/nature14367. Epub 2015 Apr 8. [PubMed:25855297]
  5. Kremeyer B, Lopera F, Cox JJ, Momin A, Rugiero F, Marsh S, Woods CG, Jones NG, Paterson KJ, Fricker FR, Villegas A, Acosta N, Pineda-Trujillo NG, Ramirez JD, Zea J, Burley MW, Bedoya G, Bennett DL, Wood JN, Ruiz-Linares A: A gain-of-function mutation in TRPA1 causes familial episodic pain syndrome. Neuron. 2010 Jun 10;66(5):671-80. doi: 10.1016/j.neuron.2010.04.030. [PubMed:20547126]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00825LevomentholapprovedyesinducerDetails
DB09061Cannabidiolapproved, investigationalunknownagonistDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB11755TetrahydrocannabivarininvestigationalyesagonistDetails
DB11345(S)-camphorexperimentalyesinhibitorDetails
DB01744CamphorapprovedyesinhibitorDetails
DB14050CannabidivarininvestigationalyesagonistDetails
DB11148Butambenapproved, withdrawnunknowninhibitorDetails