Endoglucanase 5A

Details

Name
Endoglucanase 5A
Synonyms
  • 3.2.1.4
  • Alkaline cellulase
  • Endo-1,4-beta-glucanase 5A
Gene Name
cel5A
Organism
Bacillus agaradhaerens
Amino acid sequence
>lcl|BSEQ0019083|Endoglucanase 5A
MKKITTIFVVLLMTVALFSIGNTTAADNDSVVEEHGQLSISNGELVNERGEQVQLKGMSS
HGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDI
YVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPY
AEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQV
DYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAAL
MPGANPTGGWTEAELSPSGTFVREKIRESASIPPSDPTPPSDPGEPDPTPPSDPGEYPAW
DPNQIYTNEIVYHNGQLWQAKWWTQNQEPGDPYGPWEPLN
Number of residues
400
Molecular Weight
44701.845
Theoretical pI
3.96
GO Classification
Functions
carbohydrate binding / cellulase activity
Processes
cellulose catabolic process
Components
extracellular region
General Function
Cellulase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0002426|1203 bp
ATGAAAAAGATAACTACTATTTTTGTCGTATTGCTTATGACAGTGGCGTTGTTCAGTATA
GGAAACACGACTGCTGCTGATAATGATTCAGTTGTAGAAGAACATGGGCAATTAAGTATT
AGTAACGGTGAATTAGTCAATGAACGAGGCGAACAAGTTCAGTTAAAAGGGATGAGTTCC
CATGGTTTGCAATGGTACGGTCAATTTGTAAACTATGAAAGTATGAAATGGCTAAGAGAT
GATTGGGGAATAAATGTATTCCGAGCAGCAATGTATACCTCTTCAGGAGGATATATTGAT
GATCCATCAGTAAAGGAAAAAGTAAAAGAGGCTGTTGAAGCTGCGATAGACCTTGATATA
TATGTGATCATTGATTGGCATATCCTTTCAGACAATGACCCAAATATATATAAAGAAGAA
GCGAAGGATTTCTTTGATGAAATGTCAGAGTTGTATGGAGACTATCCGAATGTGATATAC
GAAATTGCAAATGAACCGAATGGTAGTGATGTTACGTGGGGCAATCAAATAAAACCGTAT
GCAGAGGAAGTCATTCCGATTATTCGTAACAATGACCCTAATAACATTATTATTGTAGGT
ACAGGTACATGGAGTCAGGATGTCCATCATGCAGCTGATAATCAGCTTGCAGATCCTAAC
GTCATGTATGCATTTCATTTTTATGCAGGGACACATGGTCAAAATTTACGAGACCAAGTA
GATTATGCATTAGATCAAGGAGCAGCGATATTTGTTAGTGAATGGGGAACAAGTGCAGCT
ACAGGTGATGGTGGCGTGTTTTTAGATGAAGCACAAGTGTGGATTGACTTTATGGATGAA
AGAAATTTAAGCTGGGCCAACTGGTCTCTAACGCATAAAGATGAGTCATCTGCAGCGTTA
ATGCCAGGTGCAAATCCAACTGGTGGTTGGACAGAGGCTGAACTATCTCCATCTGGTACA
TTTGTGAGGGAAAAAATAAGAGAATCAGCATCTATTCCGCCAAGCGATCCAACACCGCCA
TCTGATCCAGGAGAACCGGATCCAACGCCCCCAAGTGATCCAGGAGAGTATCCAGCATGG
GATCCAAATCAAATTTACACAAATGAAATTGTGTACCATAACGGCCAGCTATGGCAAGCA
AAATGGTGGACACAAAATCAAGAGCCAGGTGACCCGTACGGTCCGTGGGAACCACTCAAT
TAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO85465
UniProtKB Entry NameGUN5_BACAG
GenBank Protein ID3193120
GenBank Gene IDAF067428
General References
  1. Davies GJ, Dauter M, Brzozowski AM, Bjornvad ME, Andersen KV, Schulein M: Structure of the Bacillus agaradherans family 5 endoglucanase at 1.6 A and its cellobiose complex at 2.0 A resolution. Biochemistry. 1998 Feb 17;37(7):1926-32. [PubMed:9485319]
  2. Davies GJ, Mackenzie L, Varrot A, Dauter M, Brzozowski AM, Schulein M, Withers SG: Snapshots along an enzymatic reaction coordinate: analysis of a retaining beta-glycoside hydrolase. Biochemistry. 1998 Aug 25;37(34):11707-13. [PubMed:9718293]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01633Deoxy-2-fluoro-beta-D-cellotriosideexperimental, investigationalunknownDetails
DB01642methyl beta-D-glucopyranosideexperimentalunknownDetails
DB02017Imidazole-Derived CellobioseexperimentalunknownDetails
DB02061CellobioseexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB035844-Thio-beta-D-glucopyranoseexperimentalunknownDetails
DB03862TetrahydrooxazineexperimentalunknownDetails
DB040862',4'-Dinitrophenyl-2deoxy-2-Fluro-B-D-CellobiosideexperimentalunknownDetails
DB04545Afegostatexperimental, investigationalunknownDetails