Cobalt-precorrin-4 C(11)-methyltransferase

Details

Name
Cobalt-precorrin-4 C(11)-methyltransferase
Synonyms
  • 2.1.1.271
  • Cobalt-precorrin-3 methylase
Gene Name
cbiF
Organism
Bacillus megaterium
Amino acid sequence
>lcl|BSEQ0010981|Cobalt-precorrin-4 C(11)-methyltransferase
MKLYIIGAGPGDPDLITVKGLKLLQQADVVLYADSLVSQDLIAKSKPGAEVLKTAGMHLE
EMVGTMLDRMREGKMVVRVHTGDPAMYGAIMEQMVLLKREGVDIEIVPGVTSVFAAAAAA
EAELTIPDLTQTVILTRAEGRTPVPEFEKLTDLAKHKCTIALFLSATLTKKVMKEFINAG
WSEDTPVVVVYKATWPDEKIVRTTVKDLDDAMRTNGIRKQAMILAGWALDPHIHDKDYRS
KLYDKTFTHGFRKGVKSE
Number of residues
258
Molecular Weight
28452.015
Theoretical pI
7.17
GO Classification
Functions
precorrin-2 dehydrogenase activity / precorrin-4 C11-methyltransferase activity
Processes
cobalamin biosynthetic process / porphyrin-containing compound biosynthetic process
General Function
Precorrin-4 c11-methyltransferase activity
Specific Function
Catalyzes the methylation of C-11 in cobalt-precorrin-4 to form cobalt-precorrin-5A.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0002774|777 bp
ATGAAGTTATACATAATCGGAGCTGGACCCGGAGATCCAGATTTAATTACCGTAAAAGGC
TTAAAATTACTTCAGCAAGCAGATGTTGTTTTATACGCTGACTCACTAGTAAGTCAAGAT
CTAATTGCTAAGTCTAAACCAGGTGCTGAAGTGTTAAAAACAGCGGGTATGCATTTAGAA
GAAATGGTCGGTACTATGCTTGATCGCATGCGTGAAGGGAAAATGGTCGTGAGAGTACAT
ACGGGAGATCCGGCTATGTACGGAGCCATTATGGAACAAATGGTGCTTTTAAAAAGAGAA
GGTGTTGATATTGAAATCGTTCCGGGCGTCACGTCCGTATTCGCTGCTGCTGCAGCGGCT
GAAGCAGAATTAACCATTCCGGATTTGACTCAGACCGTTATTTTAACTCGGGCCGAAGGA
AGAACGCCTGTACCTGAGTTTGAAAAATTAACGGATTTAGCAAAACATAAATGTACGATT
GCGTTATTTTTAAGCGCGACGCTCACAAAAAAAGTAATGAAAGAATTTATAAATGCCGGT
TGGAGTGAGGATACGCCGGTTGTAGTAGTCTATAAAGCAACGTGGCCTGATGAAAAAATT
GTTCGCACGACGGTAAAAGACCTAGATGATGCTATGCGAACAAATGGCATTCGTAAGCAG
GCTATGATTTTGGCGGGCTGGGCACTTGACCCCCATATTCATGACAAAGATTATCGTTCA
AAACTCTACGATAAAACATTTACCCACGGCTTTCGCAAGGGAGTGAAATCGGAATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO87696
UniProtKB Entry NameCBIF_BACME
GenBank Protein ID3724044
GenBank Gene IDAJ000758
General References
  1. Raux E, Lanois A, Warren MJ, Rambach A, Thermes C: Cobalamin (vitamin B12) biosynthesis: identification and characterization of a Bacillus megaterium cobI operon. Biochem J. 1998 Oct 1;335 ( Pt 1):159-66. [PubMed:9742225]
  2. Moore SJ, Lawrence AD, Biedendieck R, Deery E, Frank S, Howard MJ, Rigby SE, Warren MJ: Elucidation of the anaerobic pathway for the corrin component of cobalamin (vitamin B12). Proc Natl Acad Sci U S A. 2013 Sep 10;110(37):14906-11. doi: 10.1073/pnas.1308098110. Epub 2013 Aug 6. [PubMed:23922391]
  3. Raux E, Schubert HL, Woodcock SC, Wilson KS, Warren MJ: Cobalamin (vitamin B12) biosynthesis--cloning, expression and crystallisation of the Bacillus megaterium S-adenosyl-L-methionine-dependent cobalt-precorrin-4 transmethylase CbiF. Eur J Biochem. 1998 Jun 1;254(2):341-6. [PubMed:9660189]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails