Voltage-dependent T-type calcium channel subunit alpha-1H

Details

Name
Voltage-dependent T-type calcium channel subunit alpha-1H
Synonyms
  • Low-voltage-activated calcium channel alpha1 3.2 subunit
  • Voltage-gated calcium channel subunit alpha Cav3.2
Gene Name
CACNA1H
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001722|Voltage-dependent T-type calcium channel subunit alpha-1H
MTEGARAADEVRVPLGAPPPGPAALVGASPESPGAPGREAERGSELGVSPSESPAAERGA
ELGADEEQRVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMF
RPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVV
AGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFV
FFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGEENPFICSSRRDNGMQ
KCSHIPGRRELRMPCTLGWEAYTQPQAEGVGAARNACINWNQYYNVCRSGDSNPHNGAIN
FDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIAT
QFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYA
RWQSRWRKKVDPSAVQGQGPGHRQRRAGRHTASVHHLVYHHHHHHHHHYHFSHGSPRRPG
PEPGACDTRLVRAGAPPSPPSPGRGPPDAESVHSIYHADCHIEGPQERARVAHAAATAAA
SLRLATGLGTMNYPTILPSGVGSGKGSTSPGPKGKWAGGPPGTGGHGPLSLNSPDPYEKI
PHVVGEHGLGQAPGHLSGLSVPCPLPSPPAGTLTCELKSCPYCTRALEDPEGELSGSESG
DSDGRGVYEFTQDVRHGDRWDPTRPPRATDTPGPGPGSPQRRAQQRAAPGEPGWMGRLWV
TFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEM
LLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKLVRFLPA
LRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSL
LWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQA
EGDANRSDTDEDKTSVHFEEDFHKLRELQTTELKMCSLAVTPNGHLEGRGSLSPPLIMCT
AATPMPTPKSSPFLDAAPSLPDSRRGSSSSGDPPLGDQKPPASLRSSPCAPWGPSGAWSS
RRSSWSSLGRAPSLKRRGQCGERESLLSGEGKGSTDDEAEDGRAAPGPRATPLRRAESLD
PRPLRPAALPPTKCRDRDGQVVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEP
YKPQWCRSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDP
GSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIV
VAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAF
FIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRAAHYRWVRRKYNFDNLGQALMSLFVL
SSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHK
CRQHQEAEEARRREEKRLRRLERRRRSTFPSPEAQRRPYYADYSPTRRSIHSLCTSHYLD
LFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDR
WNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLD
TVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLT
LFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLM
KHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVARKVS
VSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCASLQ
IPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDSPRDTLDPAEP
GEKTPVRPVTQGGSLQSPPRSPRPASVRTRKHTFGQRCVSSRPAAPGGEEAEASDPADEE
VSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAEL
GSGEPGEAKAWGPEAEPALGARRKKKMSPPCISVEPPAEDEGSARPSAAEGGSTTLRRRT
PSCEATPHRDSLEPTEGSGAGGDPAAKGERWGQASCRAEHLTVPSFAFEPLDLGVPSGDP
FLDGSHSVTPESRASSSGAIVPLEPPESEPPMPVGDPPEKRRGLYLTVPQCPLEKPGSPS
ATPAPGGGADDPV
Number of residues
2353
Molecular Weight
259160.2
Theoretical pI
7.38
GO Classification
Functions
low voltage-gated calcium channel activity / metal ion binding / scaffold protein binding
Processes
aldosterone biosynthetic process / axon guidance / calcium ion import / cellular response to hormone stimulus / cellular response to potassium ion / cortisol biosynthetic process / membrane depolarization during action potential / muscle contraction / muscle organ development / myoblast fusion / positive regulation of acrosome reaction / regulation of heart contraction / regulation of membrane potential / transport
Components
caveola / integral component of membrane / plasma membrane / sarcolemma / voltage-gated calcium channel complex
General Function
Scaffold protein binding
Specific Function
Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1H gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes.
Pfam Domain Function
Transmembrane Regions
101-119 142-160 170-184 194-212 233-253 395-419 794-814 828-849 856-874 883-906 918-938 991-1015 1291-1313 1332-1352 1363-1382 1397-1418 1429-1452 1530-1555 1617-1637 1652-1673 1681-1699 1714-1737 1752-1772 1836-1863
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010610|Voltage-dependent T-type calcium channel subunit alpha-1H (CACNA1H)
ATGACCGAGGGCGCACGGGCCGCCGACGAGGTCCGGGTGCCCCTGGGCGCGCCGCCCCCT
GGCCCTGCGGCGTTGGTGGGGGCGTCCCCGGAGAGCCCCGGGGCGCCGGGACGCGAGGCG
GAGCGGGGGTCCGAGCTCGGCGTGTCACCCTCCGAGAGCCCGGCGGCCGAGCGCGGCGCG
GAGCTGGGTGCCGACGAGGAGCAGCGCGTCCCGTACCCGGCCTTGGCGGCCACGGTCTTC
TTCTGCCTCGGTCAGACCACGCGGCCGCGCAGCTGGTGCCTCCGGCTGGTCTGCAACCCA
TGGTTCGAGCACGTGAGCATGCTGGTAATCATGCTCAACTGCGTGACCCTGGGCATGTTC
CGGCCCTGTGAGGACGTTGAGTGCGGCTCCGAGCGCTGCAACATCCTGGAGGCCTTTGAC
GCCTTCATTTTCGCCTTTTTTGCGGTGGAGATGGTCATCAAGATGGTGGCCTTGGGGCTG
TTCGGGCAGAAGTGTTACCTGGGTGACACGTGGAACAGGCTGGATTTCTTCATCGTCGTG
GCGGGCATGATGGAGTACTCGTTGGACGGACACAACGTGAGCCTCTCGGCTATCAGGACC
GTGCGGGTGCTGCGGCCCCTCCGCGCCATCAACCGCGTGCCTAGCATGCGGATCCTGGTC
ACTCTGCTGCTGGATACGCTGCCCATGCTCGGGAACGTCCTTCTGCTGTGCTTCTTCGTC
TTCTTCATTTTCGGCATCGTTGGCGTCCAGCTCTGGGCTGGCCTCCTGCGGAACCGCTGC
TTCCTGGACAGTGCCTTTGTCAGGAACAACAACCTGACCTTCCTGCGGCCGTACTACCAG
ACGGAGGAGGGCGAGGAGAACCCGTTCATCTGCTCCTCACGCCGAGACAACGGCATGCAG
AAGTGCTCGCACATCCCCGGCCGCCGCGAGCTGCGCATGCCCTGCACCCTGGGCTGGGAG
GCCTACACGCAGCCGCAGGCCGAGGGGGTGGGCGCTGCACGCAACGCCTGCATCAACTGG
AACCAGTACTACAACGTGTGCCGCTCGGGTGACTCCAACCCCCACAACGGTGCCATCAAC
TTCGACAACATCGGCTACGCCTGGATTGCCATCTTCCAGGTGATCACGCTGGAAGGCTGG
GTGGACATCATGTACTACGTCATGGACGCCCACTCATTCTACAACTTCATCTATTTCATC
CTGCTCATCATCGTGGGCTCCTTCTTCATGATCAACCTGTGCCTGGTGGTGATTGCCACG
CAGTTCTCGGAGACGAAGCAGCGGGAGAGTCAGCTGATGCGGGAGCAGCGGGCACGCCAC
CTGTCCAACGACAGCACGCTGGCCAGCTTCTCCGAGCCTGGCAGCTGCTACGAAGAGCTG
CTGAAGTACGTGGGCCACATATTCCGCAAGGTCAAGCGGCGCAGCTTGCGCCTCTACGCC
CGCTGGCAGAGCCGCTGGCGCAAGAAGGTGGACCCCAGTGCTGTGCAAGGCCAGGGTCCC
GGGCACCGCCAGCGCCGGGCAGGCAGGCACACAGCCTCGGTGCACCACCTGGTCTACCAC
CACCATCACCACCACCACCACCACTACCATTTCAGCCATGGCAGCCCCCGCAGGCCCGGC
CCCGAGCCAGGCGCCTGCGACACCAGGCTGGTCCGAGCTGGCGCGCCCCCCTCGCCACCT
TCCCCAGGCCGCGGACCCCCCGACGCAGAGTCTGTGCACAGCATCTACCATGCCGACTGC
CACATAGAGGGGCCGCAGGAGAGGGCCCGGGTGGCACATGCCGCAGCCACTGCCGCTGCC
AGCCTCAGACTGGCCACAGGGCTGGGCACCATGAACTACCCCACGATCCTGCCCTCAGGG
GTGGGCAGCGGCAAAGGCAGCACCAGCCCCGGACCCAAGGGGAAGTGGGCCGGTGGACCG
CCAGGCACCGGGGGGCACGGCCCGTTGAGCTTGAACAGCCCTGATCCCTACGAGAAGATC
CCGCATGTGGTCGGGGAGCATGGACTGGGCCAGGCCCCTGGCCATCTGTCGGGCCTCAGT
GTGCCCTGCCCCCTGCCCAGCCCCCCAGCGGGCACACTGACCTGTGAGCTGAAGAGCTGC
CCGTACTGCACCCGTGCCCTGGAGGACCCGGAGGGTGAGCTCAGCGGCTCGGAAAGTGGA
GACTCAGATGGCCGTGGCGTCTATGAATTCACGCAGGACGTCCGGCACGGTGACCGCTGG
GACCCCACGCGACCACCCCGTGCGACGGACACACCAGGCCCAGGCCCAGGCAGCCCCCAG
CGGCGGGCACAGCAGAGGGCAGCCCCGGGCGAGCCAGGCTGGATGGGCCGCCTCTGGGTT
ACCTTCAGCGGCAAGCTGCGCCGCATCGTGGACAGCAAGTACTTCAGCCGTGGCATCATG
ATGGCCATCCTTGTCAACACGCTGAGCATGGGCGTGGAGTACCATGAGCAGCCCGAGGAG
CTGACTAATGCTCTGGAGATCAGCAACATCGTGTTCACCAGCATGTTTGCCCTGGAGATG
CTGCTGAAGCTGCTGGCCTGCGGCCCTCTGGGCTACATCCGGAACCCGTACAACATCTTC
GACGGCATCATCGTGGTCATCAGCGTCTGGGAGATCGTGGGGCAGGCGGACGGTGGCTTG
TCTGTGCTGCGCACCTTCCGGCTGCTGCGTGTGCTGAAGCTGGTGCGCTTTCTGCCAGCC
CTGCGGCGCCAGCTCGTGGTGCTGGTGAAGACCATGGACAACGTGGCTACCTTCTGCACG
CTGCTCATGCTCTTCATTTTCATCTTCAGCATCCTGGGCATGCACCTTTTCGGCTGCAAG
TTCAGCCTGAAGACAGACACCGGAGACACCGTGCCTGACAGGAAGAACTTCGACTCCCTG
CTGTGGGCCATCGTCACCGTGTTCCAGATCCTGACCCAGGAGGACTGGAACGTGGTCCTG
TACAACGGCATGGCCTCCACCTCCTCCTGGGCCGCCCTCTACTTCGTGGCCCTCATGACC
TTCGGCAACTATGTGCTCTTCAACCTGCTGGTGGCCATCCTCGTGGAGGGCTTCCAGGCG
GAGGGCGATGCCAACAGATCCGACACGGACGAGGACAAGACGTCGGTCCACTTCGAGGAG
GACTTCCACAAGCTCAGAGAACTCCAGACCACAGAGCTGAAGATGTGTTCCCTGGCCGTG
ACCCCCAACGGGCACCTGGAGGGACGAGGCAGCCTGTCCCCTCCCCTCATCATGTGCACA
GCTGCCACGCCCATGCCTACCCCCAAGAGCTCACCATTCCTGGATGCAGCCCCCAGCCTC
CCAGACTCTCGGCGTGGCAGCAGCAGCTCCGGGGACCCGCCACTGGGAGACCAGAAGCCT
CCGGCCAGCCTCCGAAGTTCTCCCTGTGCCCCCTGGGGCCCCAGTGGCGCCTGGAGCAGC
CGGCGCTCCAGCTGGAGCAGCCTGGGCCGTGCCCCCAGCCTCAAGCGCCGCGGCCAGTGT
GGGGAACGTGAGTCCCTGCTGTCTGGCGAGGGCAAGGGCAGCACCGACGACGAAGCTGAG
GACGGCAGGGCCGCGCCCGGGCCCCGTGCCACCCCACTGCGGCGGGCCGAGTCCCTGGAC
CCACGGCCCCTGCGGCCGGCCGCCCTCCCGCCTACCAAGTGCCGCGATCGCGACGGGCAG
GTGGTGGCCCTGCCCAGCGACTTCTTCCTGCGCATCGACAGCCACCGTGAGGATGCAGCC
GAGCTTGACGACGACTCGGAGGACAGCTGCTGCCTCCGCCTGCATAAAGTGCTGGAGCCC
TACAAGCCCCAGTGGTGCCGGAGCCGCGAGGCCTGGGCCCTCTACCTCTTCTCCCCACAG
AACCGGTTCCGCGTCTCCTGCCAGAAGGTCATCACACACAAGATGTTTGATCACGTGGTC
CTCGTCTTCATCTTCCTCAACTGCGTCACCATCGCCCTGGAGAGGCCTGACATTGATCCC
GGCAGCACCGAGCGGGTCTTCCTCAGCGTCTCCAATTACATCTTCACGGCCATCTTCGTG
GCGGAGATGATGGTGAAGGTGGTGGCCCTGGGGCTGCTGTCCGGCGAGCACGCCTACCTG
CAGAGCAGCTGGAACCTGCTGGATGGGCTGCTGGTGCTGGTGTCCCTGGTGGACATTGTC
GTGGCCATGGCCTCGGCTGGTGGCGCCAAGATCCTGGGTGTTCTGCGCGTGCTGCGTCTG
CTGCGGACCCTGCGGCCTCTGAGGGTCATCAGCCGGGCCCCGGGCCTCAAGCTGGTGGTG
GAGACGCTGATATCATCACTCAGGCCCATTGGGAACATCGTCCTCATCTGCTGCGCCTTC
TTCATCATTTTTGGCATTTTGGGTGTGCAGCTCTTCAAAGGGAAGTTCTACTACTGCGAG
GGCCCCGACACCAGGAACATCTCCACCAAGGCACAGTGCCGGGCCGCCCACTACCGCTGG
GTGCGACGCAAGTACAACTTCGACAACCTGGGCCAGGCCCTGATGTCGCTGTTCGTGCTG
TCATCCAAGGATGGATGGGTGAACATCATGTACGACGGGCTGGATGCCGTGGGTGTCGAC
CAGCAGCCTGTGCAGAACCACAACCCCTGGATGCTGCTGTACTTCATCTCCTTCCTGCTC
ATCGTCAGCTTCTTCGTGCTCAACATGTTCGTGGGCGTCGTGGTCGAGAACTTCCACAAG
TGCCGGCAGCACCAGGAGGCGGAGGAGGCGCGGCGGCGAGAGGAGAAGCGGCTGCGGCGC
CTAGAGAGGAGGCGCAGGAAGGCCCAGCGCCGGCCCTACTATGCCGACTACTCGCCCACG
CGCCGCTCCATTCACTCGCTGTGCACCAGCCACTATCTCGACCTCTTCATCACCTTCATC
ATCTGTGTCAACGTCATCACCATGTCCATGGAGCACTATAACCAACCCAAGTCGCTGGAC
GAGGCCCTCAAGTACTGCAACTACGTCTTCACCATCGTGTTTGTCTTCGAGGCTGCACTG
AAGCTGGTAGCATTTGGGTTCCGTCGGTTCTTCAAGGACAGGTGGAACCAGCTGGACCTG
GCCATCGTGCTGCTGTCACTCATGGGCATCACGCTGGAGGAGATAGAGATGAGCGCCGCG
CTGCCCATCAACCCCACCATCATCCGCATCATGCGCGTGCTTCGCATTGCCCGTGTGCTG
AAGCTGCTGAAGATGGCTACGGGCATGCGCGCCCTGCTGGACACTGTGGTGCAAGCTCTC
CCCCAGGTGGGGAACCTGGGCCTTCTTTTCATGCTCCTGTTTTTTATCTATGCTGCGCTG
GGAGTGGAGCTGTTCGGGAGGCTGGAGTGCAGTGAAGACAACCCCTGCGAGGGCCTGAGC
AGGCACGCCACCTTCAGCAACTTCGGCATGGCCTTCCTCACGCTGTTCCGCGTGTCCACG
GGGGACAACTGGAACGGGATCATGAAGGACACGCTGCGCGAGTGCTCCCGTGAGGACAAG
CACTGCCTGAGCTACCTGCCGGCCCTGTCGCCCGTCTACTTCGTGACCTTCGTGCTGGTG
GCCCAGTTCGTGCTGGTGAACGTGGTGGTGGCCGTGCTCATGAAGCACCTGGAGGAGAGC
AACAAGGAGGCACGGGAGGATGCGGAGCTGGACGCCGAGATCGAGCTGGAGATGGCGCAG
GGCCCCGGGAGTGCACGCCGGGTGGACGCGGACAGGCCTCCCTTGCCCCAGGAGAGTCCG
GGCGCCAGGGACGCCCCAAACCTGGTTGCACGCAAGGTGTCCGTGTCCAGGATGCTCTCG
CTGCCCAACGACAGCTACATGTTCAGGCCCGTGGTGCCTGCCTCGGCGCCCCACCCCCGC
CCGCTGCAGGAGGTGGAGATGGAGACCTATGGGGCCGGCACCCCCTTGGGCTCCGTTGCC
TCTGTGCACTCTCCGCCCGCAGAGTCCTGTGCCTCCCTCCAGATCCCATTGGCTGTGTCG
TCCCCAGCCAGGAGCGGCGAGCCCCTCCACGCCCTGTCCCCTCGGGGCACAGCCCGCTCC
CCCAGTCTCAGCCGGCTGCTCTGCAGACAGGAGGCTGTGCACACCGATTCCTTGGAAGGG
AAGATTGACAGCCCTAGGGACACCCTGGATCCTGCAGAGCCTGGTGAGAAAACCCCGGTG
AGGCCGGTGACCCAGGGGGGCTCCCTGCAGTCCCCACCACGCTCCCCACGGCCCGCCAGC
GTCCGCACTCGTAAGCATACCTTCGGACAGCGCTGCGTCTCCAGCCGGCCGGCGGCCCCA
GGCGGAGAGGAGGCCGAGGCCTCGGACCCAGCCGACGAGGAGGTCAGCCACATCACCAGC
TCCGCCTGCCCCTGGCAGCCCACAGCCGAGCCCCATGGCCCCGAAGCCTCTCCGGTGGCC
GGCGGCGAGCGGGACCTGCGCAGGCTCTACAGCGTGGATGCTCAGGGCTTCCTGGACAAG
CCGGGCCGGGCAGACGAGCAGTGGCGGCCCTCGGCGGAGCTGGGCAGCGGGGAGCCTGGG
GAGGCGAAGGCCTGGGGCCCTGAGGCCGAGCCCGCTCTGGGTGCGCGCAGAAAGAAGAAG
ATGAGCCCCCCCTGCATCTCGGTGGAACCCCCTGCGGAGGACGAGGGCTCTGCGCGGCCC
TCCGCGGCAGAGGGCGGCAGCACCACACTGAGGCGCAGGACCCCGTCCTGTGAGGCCACG
CCTCACAGGGACTCCCTGGAGCCCACAGAGGGCTCAGGCGCCGGGGGGGACCCTGCAGCC
AAGGGGGAGCGCTGGGGCCAGGCCTCCTGCCGGGCTGAGCACCTGACCGTCCCCAGCTTT
GCCTTTGAGCCGCTGGACCTCGGGGTCCCCAGTGGAGACCCTTTCTTGGACGGTAGCCAC
AGTGTGACCCCAGAATCCAGAGCTTCCTCTTCAGGGGCCATAGTGCCCCTGGAACCCCCA
GAATCAGAGCCTCCCATGCCCGTCGGTGACCCCCCAGAGAAGAGGCGGGGGCTGTACCTC
ACAGTCCCCCAGTGTCCTCTGGAGAAACCAGGGTCCCCCTCAGCCACCCCTGCCCCAGGG
GGTGGTGCAGATGACCCCGTGTAG
Chromosome Location
16
Locus
16p13.3
External Identifiers
ResourceLink
UniProtKB IDO95180
UniProtKB Entry NameCAC1H_HUMAN
GenBank Protein ID14670397
GenBank Gene IDAF051946
GenAtlas IDCACNA1H
HGNC IDHGNC:1395
General References
  1. Cribbs LL, Lee JH, Yang J, Satin J, Zhang Y, Daud A, Barclay J, Williamson MP, Fox M, Rees M, Perez-Reyes E: Cloning and characterization of alpha1H from human heart, a member of the T-type Ca2+ channel gene family. Circ Res. 1998 Jul 13;83(1):103-9. [PubMed:9670923]
  2. Williams ME, Washburn MS, Hans M, Urrutia A, Brust PF, Prodanovich P, Harpold MM, Stauderman KA: Structure and functional characterization of a novel human low-voltage activated calcium channel. J Neurochem. 1999 Feb;72(2):791-9. [PubMed:9930755]
  3. Jagannathan S, Punt EL, Gu Y, Arnoult C, Sakkas D, Barratt CL, Publicover SJ: Identification and localization of T-type voltage-operated calcium channel subunits in human male germ cells. Expression of multiple isoforms. J Biol Chem. 2002 Mar 8;277(10):8449-56. Epub 2001 Dec 21. [PubMed:11751928]
  4. Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR: Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16. Hum Mol Genet. 2001 Feb 15;10(4):339-52. [PubMed:11157797]
  5. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553]
  6. Kang HW, Vitko I, Lee SS, Perez-Reyes E, Lee JH: Structural determinants of the high affinity extracellular zinc binding site on Cav3.2 T-type calcium channels. J Biol Chem. 2010 Jan 29;285(5):3271-81. doi: 10.1074/jbc.M109.067660. Epub 2009 Nov 23. [PubMed:19940152]
  7. Chen Y, Lu J, Pan H, Zhang Y, Wu H, Xu K, Liu X, Jiang Y, Bao X, Yao Z, Ding K, Lo WH, Qiang B, Chan P, Shen Y, Wu X: Association between genetic variation of CACNA1H and childhood absence epilepsy. Ann Neurol. 2003 Aug;54(2):239-43. [PubMed:12891677]
  8. Heron SE, Phillips HA, Mulley JC, Mazarib A, Neufeld MY, Berkovic SF, Scheffer IE: Genetic variation of CACNA1H in idiopathic generalized epilepsy. Ann Neurol. 2004 Apr;55(4):595-6. [PubMed:15048902]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB04841FlunarizineapprovedyesinhibitorDetails
DB01023Felodipineapproved, investigationalunknowninhibitorDetails
DB00270Isradipineapproved, investigationalyesinhibitorDetails
DB01054Nitrendipineapproved, investigationalunknowninhibitorDetails
DB01118Amiodaroneapproved, investigationalunknowninhibitorDetails
DB01244Bepridilapproved, withdrawnyesinhibitorDetails
DB00568Cinnarizineapproved, investigationalyesinhibitorDetails
DB01115NifedipineapprovedunknowninhibitorDetails
DB00909Zonisamideapproved, investigationalyesinhibitorDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB00381AmlodipineapprovedyesblockerDetails
DB00153Ergocalciferolapproved, nutraceuticalnoinducerDetails
DB11093Calcium Citrateapproved, investigationalunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedunknownactivatorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09231BenidipineexperimentalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails