Adenylate cyclase type 5

Details

Name
Adenylate cyclase type 5
Synonyms
  • 4.6.1.1
  • AC5
  • Adenylate cyclase type V
  • Adenylyl cyclase 5
  • ATP pyrophosphate-lyase 5
Gene Name
ADCY5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007170|Adenylate cyclase type 5
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEG
GEGSGDGGSSADSGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQS
SLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMGL
ACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSAL
HLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLH
SQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTS
LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEM
GMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK
AGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMN
RQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFL
GRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQI
TIVPHSIFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGVF
TITLVFLAAFVNMFTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSP
WPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADL
LVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKL
QATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANF
SEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTY
DKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG
NTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPL
S
Number of residues
1261
Molecular Weight
138906.37
Theoretical pI
7.25
GO Classification
Functions
adenylate cyclase activity / adenylate cyclase binding / ATP binding / metal ion binding / protein heterodimerization activity
Processes
activation of phospholipase C activity / activation of protein kinase A activity / adenosine receptor signaling pathway / adenylate cyclase-activating dopamine receptor signaling pathway / adenylate cyclase-activating G-protein coupled receptor signaling pathway / adenylate cyclase-inhibiting dopamine receptor signaling pathway / adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / cAMP biosynthetic process / cAMP-mediated signaling / cellular response to forskolin / cellular response to glucagon stimulus / energy reserve metabolic process / epidermal growth factor receptor signaling pathway / fibroblast growth factor receptor signaling pathway / innate immune response / locomotory behavior / neuromuscular process controlling balance / neurotrophin TRK receptor signaling pathway / positive regulation of cytosolic calcium ion concentration / regulation of insulin secretion involved in cellular response to glucose stimulus / renal water homeostasis / signal transduction / small molecule metabolic process / synaptic transmission / transmembrane transport / water transport
Components
cytosol / integral component of membrane / intracellular / plasma membrane / primary cilium
General Function
Protein heterodimerization activity
Specific Function
Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling (PubMed:15385642, PubMed:26206488, PubMed:24700542). Mediates signaling downstream of ADRB1 (PubMed:24700542). Regulates the increase of free cytosolic Ca(2+) in response to increased blood glucose levels and contributes to the regulation of Ca(2+)-dependent insulin secretion (PubMed:24740569).
Pfam Domain Function
Transmembrane Regions
196-216 242-262 268-288 299-319 325-345 374-394 770-790 792-812 836-856 910-930 935-955 984-1004
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0012605|Adenylate cyclase type 5 (ADCY5)
ATGAAGTCTCAGAAAGAGGGCTGTTGCAGCAGAGGTGACCTGTCCATTCAGACAGGTCCT
GGAGGAGAATGGGCCCCACGGAGGCTTGTCTCCAATGTTCTCATTTTCTCCTGCACCAAC
ATCGTGGGTGTCTGCACCCACTATCCGGCTGAGGTCTCCCAGAGACAGGCTTTCCAGGAG
ACCCGAGAGTGCATCCAGGCGCGGCTCCACTCGCAGCGGGAGAACCAGCAGCAGGAACGG
CTCCTGCTGTCTGTCCTTCCCCGTCATGTTGCCATGGAGATGAAAGCAGACATCAACGCC
AAGCAGGAGGATATGATGTTCCATAAGATTTACATCCAGAAACATGACAACGTGAGCATC
CTGTTTGCTGACATCGAGGGCTTCACCAGCCTGGCGTCCCAGTGCACTGCACAGGAACTG
GTCATGACCCTCAACGAGCTCTTCGCCCGCTTTGACAAGCTGGCCGCAGAGAATCACTGT
TTACGTATTAAGATCCTTGGGGATTGTTATTACTGCGTCTCGGGGCTGCCTGAAGCAAGG
GCTGACCACGCCCACTGCTGTGTGGAGATGGGCATGGACATGATCGAGGCCATCTCGTTG
GTCCGGGAGGTGACAGGGGTGAACGTGAACATGCGTGTGGGAATTCACAGCGGGCGAGTA
CACTGCGGTGTCCTTGGTCTCAGGAAGTGGCAGTTCGACGTCTGGTCTAACGATGTCACG
CTAGCCAACCACATGGAGGCTGGCGGCAAGGCAGGACGCATCCACATCACCAAGGCTACA
CTCAACTACCTGAATGGGGACTACGAGGTGGAGCCAGGCTGTGGGGGCGAGCGCAACGCC
TACCTCAAGGAGCACAGTATCGAGACCTTCCTCATCCTGCGCTGCACCCAGAAGCGGAAA
GAAGAGAAGGCCATGATCGCCAAGATGAACCGCCAGAGAACCAACTCCATCGGGCACAAC
CCACCACACTGGGGGGCTGAGCGCCCCTTCTACAACCACCTGGGTGGCAACCAGGTGTCC
AAGGAGATGAAGCGGATGGGCTTTGAAGACCCCAAGGACAAGAACGCCCAGGAGAGTGCG
AACCCTGAGGATGAAGTGGATGAGTTTCTGGGCCGTGCCATTGACGCCAGGAGCATTGAT
AGGCTTCGGTCTGAGCACGTCCGCAAGTTCCTCCTGACCTTCAGGGAGCCTGACTTAGAG
AAGAAGTACTCCAAGCAGGTAGACGACCGATTTGGTGCCTATGTGGCGTGTGCCTCGCTC
GTCTTCCTCTTCATCTGCTTTGTCCAGATCACCATCGTGCCCCACTCCATATTCATGCTC
AGCTTCTACCTGACCTGTTCCCTGCTGCTGACCTTGGTGGTGTTTGTGTCTGTGATCTAC
TCCTGCGTAAAGCTCTTCCCCTCCCCACTGCAGACCCTCTCCAGGAAGATCGTGCGGTCC
AAGATGAACAGCACCCTGGTTGGGGTGTTCACCATCACCCTGGTGTTCCTGGCGGCTTTT
GTCAACATGTTCACGTGCAACTCCAGGGACCTGCTGGGCTGCTTGGCACAGGAGCACAAC
ATCAGCGCGAGCCAGGTCAACGCGTGTCACGTGGCGGAGTCGGCCGTCAACTACAGCCTG
GGCGATGAGCAGGGCTTCTGTGGCAGCCCCTGGCCCAACTGCAACTTCCCCGAGTACTTC
ACCTACAGCGTGCTGCTCAGCCTGCTGGCCTGCTCCGTGTTCCTGCAGATCAGCTGCATC
GGGAAGCTGGTGCTCATGCTGGCCATCGAGCTCATCTACGTGCTCATCGTGGAGGTGCCA
GGTGTCACGCTCTTCGACAACGCCGACCTGCTGGTCACCGCCAACGCCATAGACTTCTTC
AACAACGGGACCTCCCAGTGCCCTGAGCATGCAACCAAGGTGGCATTGAAGGTGGTGACG
CCCATCATCATCTCAGTCTTTGTGCTGGCCCTGTACCTGCACGCCCAGCAGGTGGAGTCC
ACTGCCCGCCTCGACTTCCTCTGGAAACTGCAGGCCACAGAGGAGAAAGAGGAGATGGAG
GAGCTGCAGGCCTACAACCGGCGGCTGCTGCACAACATCCTGCCCAAGGACGTGGCCGCT
CACTTCCTGGCCCGCGAGCGGCGCAATGATGAGCTCTACTATCAGTCCTGTGAGTGTGTG
GCGGTCATGTTCGCCTCCATCGCCAACTTCTCCGAGTTCTACGTTGAGCTGGAGGCCAAC
AACGAGGGTGTCGAGTGCCTGCGGCTACTCAATGAGATCATCGCTGACTTTGATGAGATC
ATCAGCGAGGATCGGTTCCGGCAGCTGGAGAAGATCAAGACCATCGGCAGCACCTACATG
GCTGCCTCCGGCCTCAACGACTCTACCTACGACAAGGTGGGCAAGACCCACATCAAGGCA
CTGGCCGACTTTGCCATGAAGCTGATGGACCAGATGAAGTACATCAATGAGCACTCCTTC
AACAACTTCCAGATGAAGATCGGGCTCAACATCGGCCCCGTGGTGGCCGGGGTGATAGGG
GCACGAAAGCCTCAGTACGACATCTGGGGCAATACCGTGAACGTGGCCAGCCGCATGGAC
AGCACCGGTGTACCCGACCGCATCCAGGTCACCACAGACATGTACCAGGTGCTGGCTGCC
AACACGTACCAGCTGGAGTGCCGGGGCGTGGTCAAGGTCAAGGGCAAAGGCGAGATGATG
ACCTACTTCCTCAATGGAGGGCCCCCGCTCAGTTAG
Chromosome Location
3
Locus
3q13.2-q21
External Identifiers
ResourceLink
UniProtKB IDO95622
UniProtKB Entry NameADCY5_HUMAN
GenBank Protein ID22212711
GenBank Gene IDAF497517
HGNC IDHGNC:236
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  2. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  3. Ludwig MG, Seuwen K: Characterization of the human adenylyl cyclase gene family: cDNA, gene structure, and tissue distribution of the nine isoforms. J Recept Signal Transduct Res. 2002 Feb-Nov;22(1-4):79-110. [PubMed:12503609]
  4. Raimundo S, Giray J, Volff JN, Schwab M, Altenbuchner J, Ratge D, Wisser H: Cloning and sequence of partial cDNAs encoding the human type V and VI adenylyl cyclases and subsequent RNA-quantification in various tissues. Clin Chim Acta. 1999 Jul;285(1-2):155-61. [PubMed:10481931]
  5. Ding Q, Gros R, Gray ID, Taussig R, Ferguson SS, Feldman RD: Raf kinase activation of adenylyl cyclases: isoform-selective regulation. Mol Pharmacol. 2004 Oct;66(4):921-8. [PubMed:15385642]
  6. Hodson DJ, Mitchell RK, Marselli L, Pullen TJ, Gimeno Brias S, Semplici F, Everett KL, Cooper DM, Bugliani M, Marchetti P, Lavallard V, Bosco D, Piemonti L, Johnson PR, Hughes SJ, Li D, Li WH, Shapiro AM, Rutter GA: ADCY5 couples glucose to insulin secretion in human islets. Diabetes. 2014 Sep;63(9):3009-21. doi: 10.2337/db13-1607. Epub 2014 Apr 16. [PubMed:24740569]
  7. Brand CS, Sadana R, Malik S, Smrcka AV, Dessauer CW: Adenylyl Cyclase 5 Regulation by Gbetagamma Involves Isoform-Specific Use of Multiple Interaction Sites. Mol Pharmacol. 2015 Oct;88(4):758-67. doi: 10.1124/mol.115.099556. Epub 2015 Jul 23. [PubMed:26206488]
  8. Chen YZ, Matsushita MM, Robertson P, Rieder M, Girirajan S, Antonacci F, Lipe H, Eichler EE, Nickerson DA, Bird TD, Raskind WH: Autosomal dominant familial dyskinesia and facial myokymia: single exome sequencing identifies a mutation in adenylyl cyclase 5. Arch Neurol. 2012 May;69(5):630-5. doi: 10.1001/archneurol.2012.54. [PubMed:22782511]
  9. Chen YZ, Friedman JR, Chen DH, Chan GC, Bloss CS, Hisama FM, Topol SE, Carson AR, Pham PH, Bonkowski ES, Scott ER, Lee JK, Zhang G, Oliveira G, Xu J, Scott-Van Zeeland AA, Chen Q, Levy S, Topol EJ, Storm D, Swanson PD, Bird TD, Schork NJ, Raskind WH, Torkamani A: Gain-of-function ADCY5 mutations in familial dyskinesia with facial myokymia. Ann Neurol. 2014 Apr;75(4):542-9. doi: 10.1002/ana.24119. Epub 2014 Mar 13. [PubMed:24700542]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB068432',5'-DIDEOXY-ADENOSINE 3'-MONOPHOSPHATEexperimentalunknownDetails
DB02587Colforsinexperimental, investigationalunknownDetails
DB09121Aurothioglucoseapproved, withdrawnunknownDetails