Cytochrome c3

Details

Name
Cytochrome c3
Synonyms
  • Cytochrome c3 precursor
Gene Name
Not Available
Organism
Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)
Amino acid sequence
>lcl|BSEQ0012026|Cytochrome c3
MKKMFLTGVLALAVAIAMPALAAAPKAPADGLKMDKTKQPVVFNHSTHKAVKCGDCHHPV
NGKEDYQKCATAGCHDNMDKKDKSAKGYYHAMHDKGTKFKSCVGCHLETAGADAAKKKEL
TGCKGSKCHS
Number of residues
130
Molecular Weight
13843.065
Theoretical pI
9.54
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
Processes
anaerobic respiration
Components
periplasmic space
General Function
Metal ion binding
Specific Function
Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0012027|Cytochrome c3
ATGAAAAAGATGTTCCTCACCGGTGTGCTCGCGCTGGCCGTTGCCATCGCCATGCCCGCC
CTTGCCGCCGCCCCGAAGGCCCCTGCCGACGGTCTGAAGATGGACAAGACCAAGCAGCCC
GTGGTCTTCAACCACTCGACCCACAAGGCCGTGAAGTGTGGCGACTGTCACCACCCGGTC
AACGGCAAGGAAGACTACCAGAAGTGCGCCACCGCCGGTTGCCACGACAACATGGACAAG
AAGGACAAGTCCGCCAAGGGCTACTACCACGCCATGCATGACAAGGGCACCAAGTTCAAG
AGCTGCGTGGGCTGCCACCTTGAAACCGCCGGCGCCGACGCCGCCAAGAAAAAGGAACTG
ACGGGCTGCAAGGGCTCCAAGTGCCATAGCTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00132
UniProtKB Entry NameCYC3_DESVM
GenBank Gene IDD31702
General References
  1. Shinkai W, Hase T, Yagi T, Matsubara H: Amino acid sequence of cytochrome c3 from Desulfovibrio vulgaris, Miyazaki. J Biochem. 1980 Jun;87(6):1747-56. [PubMed:6249799]
  2. Higuchi Y, Bando S, Kusunoki M, Matsuura Y, Yasuoka N, Kakudo M, Yamanaka T, Yagi T, Inokuchi H: The structure of cytochrome c3 from Desulfovibrio vulgaris Miyazaki at 2.5 A resolution. J Biochem. 1981 May;89(5):1659-62. [PubMed:6268619]
  3. Park JS, Kano K, Morimoto Y, Higuchi Y, Yasuoka N, Ogata M, Niki K, Akutsu H: 1H NMR studies on ferricytochrome c3 from Desulfovibrio vulgaris Miyazaki F and its interaction with ferredoxin I. J Biomol NMR. 1991 Sep;1(3):271-82. [PubMed:1668723]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails