Cytochrome c3, 13 kDa

Details

Name
Cytochrome c3, 13 kDa
Synonyms
Not Available
Gene Name
Not Available
Organism
Desulfovibrio baculatus (strain Norway 4)
Amino acid sequence
>lcl|BSEQ0012139|Cytochrome c3, 13 kDa
ADAPGDDYVISAPEGMKAKPKGDKPGALQKTVPFPHTKHATVECVQCHHTLEADGGAVKK
CTTSGCHDSLEFRDKANAKDIKLVENAFHTQCIDCHKALKKDKKPTGPTACGKCHTTN
Number of residues
118
Molecular Weight
12622.275
Theoretical pI
8.23
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
Processes
anaerobic respiration
Components
periplasmic space
General Function
Metal ion binding
Specific Function
Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00136
UniProtKB Entry NameCYC31_DESNO
General References
  1. Bruschi M, Leroy G, Guerlesquin F, Bonicel J: Amino-acid sequence of the cytochrome c3 (M(r) 26,000) from Desulfovibrio desulfuricans Norway and a comparison with those of the other polyhemic cytochromes from Desulfovibrio. Biochim Biophys Acta. 1994 Mar 16;1205(1):123-31. [PubMed:8142476]
  2. Loutfi M, Guerlesquin F, Bianco P, Haladjian J, Bruschi M: Comparative studies of polyhemic cytochromes c isolated from Desulfovibrio vulgaris (Hildenborough) and Desulfovibrio desulfuricans (Norway). Biochem Biophys Res Commun. 1989 Mar 15;159(2):670-6. [PubMed:2539120]
  3. Haser R, Pierrot M, Frey M, Payan F, Astier JP, Bruschi M, Le Gall J: Structure and sequence of the multihaem cytochrome c3. Nature. 1979 Dec 20-27;282(5741):806-10. [PubMed:229424]
  4. Pierrot M, Haser R, Frey M, Payan F, Astier JP: Crystal structure and electron transfer properties of cytochrome c3. J Biol Chem. 1982 Dec 10;257(23):14341-8. [PubMed:6292223]
  5. Czjzek M, Payan F, Guerlesquin F, Bruschi M, Haser R: Crystal structure of cytochrome c3 from Desulfovibrio desulfuricans Norway at 1.7 A resolution. J Mol Biol. 1994 Nov 4;243(4):653-67. [PubMed:7966289]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails