Cytochrome c3, 13 kDa

Details

Name

Cytochrome c3, 13 kDa

Synonyms

Not Available

Gene Name

Not Available

Organism

Desulfovibrio baculatus (strain Norway 4)

Amino acid sequence

>lcl|BSEQ0012139|Cytochrome c3, 13 kDa
ADAPGDDYVISAPEGMKAKPKGDKPGALQKTVPFPHTKHATVECVQCHHTLEADGGAVKK
CTTSGCHDSLEFRDKANAKDIKLVENAFHTQCIDCHKALKKDKKPTGPTACGKCHTTN

Number of residues

118

Molecular Weight

12622.275

Theoretical pI

8.23

GO Classification

Functions

electron carrier activity / heme binding / metal ion binding

Processes

anaerobic respiration

Components

periplasmic space

General Function

Metal ion binding

Specific Function

Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin.

Pfam Domain Function

• Cytochrom_CIII (PF02085)

Transmembrane Regions

Not Available

Cellular Location

Periplasm

Chromosome Location

Not Available

Locus

Not Available

External Identifiers

Resource	Link
UniProtKB ID	P00136
UniProtKB Entry Name	CYC31_DESNO

General References

1. Bruschi M, Leroy G, Guerlesquin F, Bonicel J: Amino-acid sequence of the cytochrome c3 (M(r) 26,000) from Desulfovibrio desulfuricans Norway and a comparison with those of the other polyhemic cytochromes from Desulfovibrio. Biochim Biophys Acta. 1994 Mar 16;1205(1):123-31. [Article]
2. Loutfi M, Guerlesquin F, Bianco P, Haladjian J, Bruschi M: Comparative studies of polyhemic cytochromes c isolated from Desulfovibrio vulgaris (Hildenborough) and Desulfovibrio desulfuricans (Norway). Biochem Biophys Res Commun. 1989 Mar 15;159(2):670-6. [Article]
3. Haser R, Pierrot M, Frey M, Payan F, Astier JP, Bruschi M, Le Gall J: Structure and sequence of the multihaem cytochrome c3. Nature. 1979 Dec 20-27;282(5741):806-10. [Article]
4. Pierrot M, Haser R, Frey M, Payan F, Astier JP: Crystal structure and electron transfer properties of cytochrome c3. J Biol Chem. 1982 Dec 10;257(23):14341-8. [Article]
5. Czjzek M, Payan F, Guerlesquin F, Bruschi M, Haser R: Crystal structure of cytochrome c3 from Desulfovibrio desulfuricans Norway at 1.7 A resolution. J Mol Biol. 1994 Nov 4;243(4):653-67. [Article]

Drug Relations

Drug Relations

DrugBank ID	Name	Drug group	Pharmacological action?	Actions	Details
DB03317	Ferroheme C	experimental	unknown		Details