Cytochrome c3

Details

Name
Cytochrome c3
Synonyms
  • Cytochrome c551.5
  • Cytochrome c7
Gene Name
cyd
Organism
Desulfuromonas acetoxidans
Amino acid sequence
>lcl|BSEQ0016972|Cytochrome c3
ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPT
KCGGCHIK
Number of residues
68
Molecular Weight
7262.195
Theoretical pI
8.62
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
Processes
anaerobic respiration
General Function
Metal ion binding
Specific Function
Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005967|207 bp
GCTGATGTGGTGACGTATGAGAATAAGAAGGGCAACGTTACCTTTGACCACAAAGCTCAT
GCCGAGAAACTGGGCTGTGACGCATGTCACGAAGGTACTCCGGCAAAGATTGCTATCGAC
AAGAAGTCTGCTCACAAAGACGCGTGCAAAACCTGCCACAAAAGCAACAATGGCCCCACC
AAATGTGGCGGCTGCCATATCAAATAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00137
UniProtKB Entry NameCYC3_DESAC
GenBank Gene IDAF005234
General References
  1. Ambler RP: The amino acid sequence of cytochrome c-551.5 (Cytochrome c(7)) from the green photosynthetic bacterium Chloropseudomonas ethylica. FEBS Lett. 1971 Nov 1;18(2):351-353. [Article]
  2. Aubert C, Lojou E, Bianco P, Rousset M, Durand MC, Bruschi M, Dolla A: The Desulfuromonas acetoxidans triheme cytochrome c7 produced in Desulfovibrio desulfuricans retains its metal reductase activity. Appl Environ Microbiol. 1998 Apr;64(4):1308-12. [Article]
  3. Turner DL, Costa HS, Coutinho IB, Legall J, Xavier AV: Assignment of the ligand geometry and redox potentials of the trihaem ferricytochrome c3 from Desulfuromonas acetoxidans. Eur J Biochem. 1997 Jan 15;243(1-2):474-81. [Article]
  4. Assfalg M, Bertini I, Bruschi M, Michel C, Turano P: The metal reductase activity of some multiheme cytochromes c: NMR structural characterization of the reduction of chromium(VI) to chromium(III) by cytochrome c(7). Proc Natl Acad Sci U S A. 2002 Jul 23;99(15):9750-4. Epub 2002 Jul 15. [Article]
  5. Czjzek M, Arnoux P, Haser R, Shepard W: Structure of cytochrome c7 from Desulfuromonas acetoxidans at 1.9 A resolution. Acta Crystallogr D Biol Crystallogr. 2001 May;57(Pt 5):670-8. Epub 2001 Apr 24. [Article]
  6. Banci L, Bertini I, Bruschi M, Sompornpisut P, Turano P: NMR characterization and solution structure determination of the oxidized cytochrome c7 from Desulfuromonas acetoxidans. Proc Natl Acad Sci U S A. 1996 Dec 10;93(25):14396-400. [Article]
  7. Assfalg M, Banci L, Bertini I, Bruschi M, Turano P: 800 MHz 1H NMR solution structure refinement of oxidized cytochrome c7 from Desulfuromonas acetoxidans. Eur J Biochem. 1998 Sep 1;256(2):261-70. [Article]
  8. Assfalg M, Banci L, Bertini I, Bruschi M, Giudici-Orticoni MT, Turano P: A proton-NMR investigation of the fully reduced cytochrome c7 from Desulfuromonas acetoxidans. Comparison between the reduced and the oxidized forms. Eur J Biochem. 1999 Dec;266(2):634-43. [Article]
  9. Assfalg M, Bertini I, Turano P, Bruschi M, Durand MC, Giudici-Orticoni MT, Dolla A: A quick solution structure determination of the fully oxidized double mutant K9-10A cytochrome c7 from Desulfuromonas acetoxidans and mechanistic implications. J Biomol NMR. 2002 Feb;22(2):107-22. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Ferroheme CexperimentalunknownDetails