Cytochrome c'
Details
- Name
- Cytochrome c'
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Alcaligenes xylosoxydans xylosoxydans
- Amino acid sequence
>lcl|BSEQ0012067|Cytochrome c' QFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFG PGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACH DAYRKKK
- Number of residues
- 127
- Molecular Weight
- 13628.35
- Theoretical pI
- 9.52
- GO Classification
- Functionselectron carrier activity / heme binding / iron ion bindingProcesseselectron transport chainComponentsperiplasmic space
- General Function
- Iron ion binding
- Specific Function
- Cytochrome c' is the most widely occurring bacterial c-type cytochrome. Cytochromes c' are high-spin proteins and the heme has no sixth ligand. Their exact function is not known.
- Pfam Domain Function
- Cytochrom_C_2 (PF01322)
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00138 UniProtKB Entry Name CYCP_ALCXX - General References
- Ambler RP: The amino acid sequence of cytochrome c' from Alcaligenes sp. N.C.I.B. 11015. Biochem J. 1973 Dec;135(4):751-8. [Article]
- Dobbs AJ, Anderson BF, Faber HR, Baker EN: Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures. Acta Crystallogr D Biol Crystallogr. 1996 Mar 1;52(Pt 2):356-68. [Article]
- Lawson DM, Stevenson CE, Andrew CR, Eady RR: Unprecedented proximal binding of nitric oxide to heme: implications for guanylate cyclase. EMBO J. 2000 Nov 1;19(21):5661-71. [Article]
- Andrew CR, Green EL, Lawson DM, Eady RR: Resonance Raman studies of cytochrome c' support the binding of NO and CO to opposite sides of the heme: implications for ligand discrimination in heme-based sensors. Biochemistry. 2001 Apr 3;40(13):4115-22. [Article]