Chloramphenicol acetyltransferase 3

Details

Name
Chloramphenicol acetyltransferase 3
Synonyms
  • 2.3.1.28
  • CAT-III
  • Chloramphenicol acetyltransferase III
Gene Name
cat3
Organism
Escherichia coli
Amino acid sequence
>lcl|BSEQ0022274|Chloramphenicol acetyltransferase 3
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQ
AVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVME
RYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLL
LPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
Number of residues
213
Molecular Weight
24993.32
Theoretical pI
6.15
GO Classification
Functions
chloramphenicol O-acetyltransferase activity
Processes
response to antibiotic
General Function
Chloramphenicol o-acetyltransferase activity
Specific Function
This enzyme is an effector of chloramphenicol resistance in bacteria.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0003061|642 bp
ATGAACTATACAAAATTTGATGTAAAAAATTGGGTTCGCCGTGAGCATTTTGAGTTTTAT
CGGCATCGTTTACCATGTGGTTTTAGCTTAACAAGCAAAATTGATATCACGACGTTAAAA
AAGTCATTGGATGATTCAGCGTATAAGTTTTATCCGGTAATGATCTATCTGATTGCTCAG
GCCGTGAATCAATTTGATGAGTTGAGAATGGCGATAAAAGATGATGAATTGATCGTATGG
GATTCAGTCGACCCACAATTCACCGTATTCCATCAAGAAACAGAGACATTTTCAGCACTG
AGTTGCCCATACTCATCCGATATTGATCAATTTATGGTGAATTATTTATCGGTAATGGAA
CGTTATAAAAGTGATACCAAGTTATTTCCTCAAGGGGTAACACCAGAAAATCATTTAAAT
ATTTCAGCATTACCTTGGGTTAATTTTGATAGCTTTAATTTAAATGTTGCTAATTTTACC
GATTATTTTGCACCCATTATAACAATGGCAAAATATCAGCAAGAAGGGGATAGACTGTTA
TTGCCGCTCTCAGTACAGGTTCATCATGCAGTTTGTGATGGCTTCCATGTTGCACGCTTT
ATTAATCGGCTACAAGAGTTGTGTAACAGTAAATTAAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00484
UniProtKB Entry NameCAT3_ECOLX
GenBank Protein ID47025
GenBank Gene IDX07848
General References
  1. Murray IA, Hawkins AR, Keyte JW, Shaw WV: Nucleotide sequence analysis and overexpression of the gene encoding a type III chloramphenicol acetyltransferase. Biochem J. 1988 May 15;252(1):173-9. [PubMed:3048245]
  2. Leslie AG, Moody PC, Shaw WV: Structure of chloramphenicol acetyltransferase at 1.75-A resolution. Proc Natl Acad Sci U S A. 1988 Jun;85(12):4133-7. [PubMed:3288984]
  3. Leslie AG: Refined crystal structure of type III chloramphenicol acetyltransferase at 1.75 A resolution. J Mol Biol. 1990 May 5;213(1):167-86. [PubMed:2187098]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02703Fusidic acidapproved, investigationalunknowninhibitorDetails
DB00446Chloramphenicolapproved, vet_approvedunknownsubstrateDetails