Trypsin

Details

Name
Trypsin
Synonyms
  • 3.4.21.4
  • SGT
Gene Name
sprT
Organism
Streptomyces griseus
Amino acid sequence
>lcl|BSEQ0016501|Trypsin
MKHFLRALKRCSVAVATVAIAVVGLQPVTASAAPNPVVGGTRAAQGEFPFMVRLSMGCGG
ALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGYNGTGKDWA
LIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSA
YGNELVANEEICAGYPDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPG
VYTEVSTFASAIASAARTL
Number of residues
259
Molecular Weight
26776.13
Theoretical pI
8.46
GO Classification
Functions
serine-type endopeptidase activity
General Function
Serine-type endopeptidase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0003221|1059 bp
GTGTCCGGCGCTCCCCCGCGGCGGCGGTCCCGCACGGCGTACGTGACACGACCGCTCCCA
GCCGTACGGGGTCGTTCCGGGCGGCGCGTCCCCGGTCCGCGTGACCCGGGCGGTCCTGGA
GGGGCGGTGGTGGCGCGTACGAGCTTGGCCGAAATGTGCGCCTTGTGGCAGCGGCCACCC
GTTCGTCGACAATCGCAGCATCTTGACGGGTGCATGACCATGCCGTCGCGCCCCGTCGGG
GTTCCCACAGCGACCCCCCACGAAAGAAGGCAATCCGTGAAGCACTTCCTGCGTGCGCTG
AAGAGATGCTCCGTCGCCGTCGCCACCGTCGCCATCGCGAGTCGTCGGCCTCCAGCCCGT
CACCGGCCTCGGCCGCCCCCAACCCGCGTCGTCGGCGGAACCCGCGCGGCCCAGGGCGAG
TTCCCCTTCATGGTCCGGCTCTCCATGGGCTGCGGCGGCGCCCTCTACGCCCAGGACATC
GTCCTCACCGCGGCCCACTGCGTGAGCGGATCGGGCAACAACACCTCGATCACGGCCACC
GGCGGCGTCGTCGACCTCCAGTCGTCCAGCGCCGTCAAGGTCCGCTCCACCAAGGTCCTC
CAGGCCCCCGGCTACAACGGCACCGGCAAGGACTGGGCGCTCATCAAGCTCGCCCAGCCC
ATCAACCAGCCCACGCTGAAGATCGCCACCACCACCGCCTACAACCAGGGCACGTTCACC
GTCGCCGGCTGGGGCGCCAACCGCGAGGGCGGCAGCCAGCAGCGCTACCTGCTCAAGGCC
AACGTCCCGTTCGTCTCCGACGCCGCCTGCCGCTCCGCGTACGGCAACGAGCTCGTGGCC
AACGAGGAGATCTGCGCCGGATACCCCGACACCGGTGGCGTCGACACCTGCCAGGGTGAC
TCCGGCGGCCCGATGTTCCGCAAGGACAACGCCGACGAGTGGATCCAGGTCGGCATCGTC
AGCTGGGGCTACGGCTGCGCCCGGCCCGGCTACCCGGGTGTCTACACCGAGGTCTCGACC
TTCGCTTCCGCCATCGCCTCGGCCGCCCGCACGCTCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00775
UniProtKB Entry NameTRYP_STRGR
GenBank Protein ID409446
GenBank Gene IDM64471
General References
  1. Kim JC, Cha SH, Jeong ST, Oh SK, Byun SM: Molecular cloning and nucleotide sequence of Streptomyces griseus trypsin gene. Biochem Biophys Res Commun. 1991 Dec 16;181(2):707-13. [PubMed:1755852]
  2. Olafson RW, Jurasek L, Carpenter MR, Smillie LB: Amino acid sequence of Streptomyces griseus trypsin. Cyanogen bromide fragments and complete sequence. Biochemistry. 1975 Mar 25;14(6):1168-77. [PubMed:804314]
  3. Read RJ, James MN: Refined crystal structure of Streptomyces griseus trypsin at 1.7 A resolution. J Mol Biol. 1988 Apr 5;200(3):523-51. [PubMed:3135412]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03127BenzamidineexperimentalunknownDetails