Tryptophan--tRNA ligase

Details

Name
Tryptophan--tRNA ligase
Synonyms
  • 6.1.1.2
  • TrpRS
  • Tryptophanyl-tRNA synthetase
Gene Name
trpS
Organism
Geobacillus stearothermophilus
Amino acid sequence
>lcl|BSEQ0010937|Tryptophan--tRNA ligase
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRR
LAAKYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSA
GLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVG
ARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISN
LLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVL
DEGAEKANRVASEMVRKMEQAMGLGRRR
Number of residues
328
Molecular Weight
37192.385
Theoretical pI
6.64
GO Classification
Functions
ATP binding / tryptophan-tRNA ligase activity
Processes
tryptophanyl-tRNA aminoacylation
Components
cytoplasm
General Function
Tryptophan-trna ligase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0002666|987 bp
ATGAAAACCATTTTTTCCGGCATTCAGCCAAGCGGCGTCATCACCATTGGCAACTATATT
GGGGCGCTGCGGCAGTTTGTCGAGCTGCAGCATGAATACAACTGCTATTTTTGCATCGTT
GACCAACACGCCATTACCGTTTGGCAAGACCCACACGAACTGCGGCAAAACATCCGCCGC
CTCGCCGCAAAGTATTTGGCCGTCGGCATCGACCCGACGCAAGCGACGTTGTTCATCCAG
TCAGAAGTGCCGGCGCACGCTCAAGCCGCTTGGATGCTGCAGTGCATCGTTTATATCGGC
GAACTTGAGCGGATGACGCAATTTAAAGAAAAATCGGCCGGCAAAGAGGCGGTCAGCGCC
GGGCTGCTCACGTACCCGCCGCTGATGGCCGCTGACATTTTGCTTTATAACACCGACATC
GTCCCGGTCGGCGAAGACCAAAAGCAGCATATCGAATTGACGCGGGATCTGGCCGAGCGC
TTCAACAAACGGTATGGCGAGCTGTTTACGATCCCTGAGGCGCGCATTCCGAAAGTCGGC
GCCCGCATCATGTCGCTTGTCGACCCGACGAAAAAAATGAGCAAATCCGACCCCAACCCG
AAAGCGTACATCACACTGCTTGACGATGCGAAAACGATCGAGAAGAAGATCAAAAGCGCG
GTCACCGACTCGGAAGGAACGATTCGCTACGACAAAGAAGCGAAGCCAGGCATTTCGAAC
TTGCTCAATATTTATTCGACCCTATCCGGTCAATCGATCGAGGAGTTGGAGCGGCAATAC
GAAGGAAAAGGATACGGCGTCTTCAAAGCAGACCTCGCTCAAGTCGTCATCGAAACGCTT
CGACCGATTCAAGAGCGGTATCACCATTGGATGGAAAGCGAGGAGCTTGACCGCGTGTTG
GATGAAGGGGCGGAAAAAGCAAATCGGGTTGCATCGGAAATGGTGCGAAAAATGGAGCAA
GCCATGGGGCTCGGGCGGCGGCGGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00953
UniProtKB Entry NameSYW_GEOSE
GenBank Protein ID143784
GenBank Gene IDM14742
General References
  1. Barstow DA, Sharman AF, Atkinson T, Minton NP: Cloning and complete nucleotide sequence of the Bacillus stearothermophilus tryptophanyl tRNA synthetase gene. Gene. 1986;46(1):37-45. [PubMed:3026925]
  2. Winter GP, Hartley BS: The amino acid sequence of tryptophanyl tRNA synthetase from Bacillus stearothermophilus. FEBS Lett. 1977 Aug 15;80(2):340-2. [PubMed:891985]
  3. Doublie S, Bricogne G, Gilmore C, Carter CW Jr: Tryptophanyl-tRNA synthetase crystal structure reveals an unexpected homology to tyrosyl-tRNA synthetase. Structure. 1995 Jan 15;3(1):17-31. [PubMed:7743129]
  4. Ilyin VA, Temple B, Hu M, Li G, Yin Y, Vachette P, Carter CW Jr: 2.9 A crystal structure of ligand-free tryptophanyl-tRNA synthetase: domain movements fragment the adenine nucleotide binding site. Protein Sci. 2000 Feb;9(2):218-31. [PubMed:10716174]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01831Tryptophanyl-5'ampexperimentalunknownDetails
DB00150Tryptophanapproved, nutraceutical, withdrawnunknowninhibitorDetails
DB04272Citric acidapproved, nutraceutical, vet_approvedunknownDetails
DB04537L-TryptophanamideexperimentalunknownDetails
DB00150Tryptophanapproved, nutraceutical, withdrawnunknownsubstrateinhibitorDetails