Pro-opiomelanocortin
Details
- Name
- Pro-opiomelanocortin
- Synonyms
- Corticotropin-lipotropin
- POMC
- Gene Name
- POMC
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0016262|Pro-opiomelanocortin MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF MTSEKSQTPLVTLFKNAIIKNAYKKGE
- Number of residues
- 267
- Molecular Weight
- 29423.72
- Theoretical pI
- 7.75
- GO Classification
- FunctionsG-protein coupled receptor binding / hormone activity / receptor binding / type 1 melanocortin receptor binding / type 3 melanocortin receptor binding / type 4 melanocortin receptor bindingProcessescell-cell signaling / cellular pigmentation / cellular protein metabolic process / generation of precursor metabolites and energy / glucose homeostasis / negative regulation of tumor necrosis factor production / neuropeptide signaling pathway / peptide hormone processing / positive regulation of transcription from RNA polymerase II promoter / regulation of appetite / regulation of blood pressure / regulation of corticosterone secretion / regulation of glycogen metabolic process / signal transductionComponentscytoplasm / extracellular region / extracellular space / peroxisomal matrix / secretory granule / secretory granule lumen
- General Function
- Type 4 melanocortin receptor binding
- Specific Function
- ACTH stimulates the adrenal glands to release cortisol.MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes.Beta-endorphin and Met-enkephalin are endogenous opiates.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0016263|Pro-opiomelanocortin (POMC) ATGCCGAGATCGTGCTGCAGCCGCTCGGGGGCCCTGTTGCTGGCCTTGCTGCTTCAGGCC TCCATGGAAGTGCGTGGCTGGTGCCTGGAGAGCAGCCAGTGTCAGGACCTCACCACGGAA AGCAACCTGCTGGAGTGCATCCGGGCCTGCAAGCCCGACCTCTCGGCCGAGACTCCCATG TTCCCGGGAAATGGCGACGAGCAGCCTCTGACCGAGAACCCCCGGAAGTACGTCATGGGC CACTTCCGCTGGGACCGATTCGGCCGCCGCAACAGCAGCAGCAGCGGCAGCAGCGGCGCA GGGCAGAAGCGCGAGGACGTCTCAGCGGGCGAAGACTGCGGCCCGCTGCCTGAGGGCGGC CCCGAGCCCCGCAGCGATGGTGCCAAGCCGGGCCCGCGCGAGGGCAAGCGCTCCTACTCC ATGGAGCACTTCCGCTGGGGCAAGCCGGTGGGCAAGAAGCGGCGCCCAGTGAAGGTGTAC CCTAACGGCGCCGAGGACGAGTCGGCCGAGGCCTTCCCCCTGGAGTTCAAGAGGGAGCTG ACTGGCCAGCGACTCCGGGAGGGAGATGGCCCCGACGGCCCTGCCGATGACGGCGCAGGG GCCCAGGCCGACCTGGAGCACAGCCTGCTGGTGGCGGCCGAGAAGAAGGACGAGGGCCCC TACAGGATGGAGCACTTCCGCTGGGGCAGCCCGCCCAAGGACAAGCGCTACGGCGGTTTC ATGACCTCCGAGAAGAGCCAGACGCCCCTGGTGACGCTGTTCAAAAACGCCATCATCAAG AACGCCTACAAGAAGGGCGAGTGA
- Chromosome Location
- 2
- Locus
- 2p23.3
- External Identifiers
Resource Link UniProtKB ID P01189 UniProtKB Entry Name COLI_HUMAN GenBank Protein ID 190188 GenBank Gene ID M38297 GenAtlas ID POMC HGNC ID HGNC:9201 - General References
- Takahashi H, Teranishi Y, Nakanishi S, Numa S: Isolation and structural organization of the human corticotropin--beta-lipotropin precursor gene. FEBS Lett. 1981 Nov 30;135(1):97-102. [Article]
- Whitfeld PL, Seeburg PH, Shine J: The human pro-opiomelanocortin gene: organization, sequence, and interspersion with repetitive DNA. DNA. 1982;1(2):133-43. [Article]
- Takahashi H, Hakamata Y, Watanabe Y, Kikuno R, Miyata T, Numa S: Complete nucleotide sequence of the human corticotropin-beta-lipotropin precursor gene. Nucleic Acids Res. 1983 Oct 11;11(19):6847-58. [Article]
- Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Golovin SIa, Karginov VA, Bondar' AA, Beklemishev AB, Chekhranova MK: [Synthesis, cloning and primary structure of DNA complementary to mRNA for human pituitary pro-opiomelanocortin]. Bioorg Khim. 1987 Apr;13(4):562-4. [Article]
- Chang AC, Cochet M, Cohen SN: Structural organization of human genomic DNA encoding the pro-opiomelanocortin peptide. Proc Natl Acad Sci U S A. 1980 Aug;77(8):4890-4. [Article]
- Seidah NG, Chretien M: Complete amino acid sequence of a human pituitary glycopeptide: an important maturation product of pro-opiomelanocortin. Proc Natl Acad Sci U S A. 1981 Jul;78(7):4236-40. [Article]
- Seidah NG, Rochemont J, Hamelin J, Lis M, Chretien M: Primary structure of the major human pituitary pro-opiomelanocortin NH2-terminal glycopeptide. Evidence for an aldosterone-stimulating activity. J Biol Chem. 1981 Aug 10;256(15):7977-84. [Article]
- Seidah NG, Rochemont J, Hamelin J, Benjannet S, Chretien M: The missing fragment of the pro-sequence of human pro-opiomelanocortin: sequence and evidence for C-terminal amidation. Biochem Biophys Res Commun. 1981 Sep 30;102(2):710-6. [Article]
- Bennett HP, Lowry PJ, McMartin C: Confirmation of the 1-20 amino acid sequence of human adrenocorticotrophin. Biochem J. 1973 May;133(1):11-3. [Article]
- LEE TH, LERNER AB, BUETTNER-JANUSCH V: On the structure of human corticotropin (adrenocorticotropic hormone). J Biol Chem. 1961 Nov;236:2970-4. [Article]
- Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [Article]
- Riniker B, Sieber P, Rittel W, Zuber H: Revised amino-acid sequences for porcine and human adrenocorticotrophic hormone. Nat New Biol. 1972 Jan 26;235(56):114-5. [Article]
- Sieber P, Rittel W, Riniker B: [Synthesis of the human adrenal cortex hormone ( h ACTH) with a revised amino acid sequence]. Helv Chim Acta. 1972;55(4):1243-66. [Article]
- Yamashiro D, Li CH: Adrenocorticotropins. 44. Total synthesis of the human hormone by the solid-phase method. J Am Chem Soc. 1973 Feb 21;95(4):1310-5. [Article]
- Li CH, Chung D: Primary structure of human beta-lipotropin. Nature. 1976 Apr 15;260(5552):622-4. [Article]
- Dragon N, Seidah NG, Lis M, Routhier R, Chretien M: Primary structure and morphine-like activity of human beta-endorphin. Can J Biochem. 1977 Jun;55(6):666-70. [Article]
- Bovenberg RA, Burbach JP, Wiegant VM, Veeneman GH, van Boom JH, Baas PD, Jansz HS, de Wied D: gamma-Endorphin and schizophrenia: amino acid composition of gamma-endorphin and nucleotide sequence of gamma-endorphin cDNA from pituitary glands of schizophrenic patients. Brain Res. 1986 Jun 18;376(1):29-37. [Article]
- Fenger M, Johnsen AH: Alpha-amidated peptides derived from pro-opiomelanocortin in normal human pituitary. Biochem J. 1988 Mar 15;250(3):781-8. [Article]
- Morris JC, Savva D, Lowry PJ: Reduced expression of a naturally deleted form of human proopiomelanocortin complementary deoxyribonucleic acid after transfection into Chinese hamster ovary cells. Endocrinology. 1995 Jan;136(1):195-201. [Article]
- Krude H, Biebermann H, Luck W, Horn R, Brabant G, Gruters A: Severe early-onset obesity, adrenal insufficiency and red hair pigmentation caused by POMC mutations in humans. Nat Genet. 1998 Jun;19(2):155-7. [Article]
- Baker M, Gaukrodger N, Mayosi BM, Imrie H, Farrall M, Watkins H, Connell JM, Avery PJ, Keavney B: Association between common polymorphisms of the proopiomelanocortin gene and body fat distribution: a family study. Diabetes. 2005 Aug;54(8):2492-6. [Article]
- Beranova-Giorgianni S, Zhao Y, Desiderio DM, Giorgianni F: Phosphoproteomic analysis of the human pituitary. Pituitary. 2006;9(2):109-20. [Article]
- Hinney A, Becker I, Heibult O, Nottebom K, Schmidt A, Ziegler A, Mayer H, Siegfried W, Blum WF, Remschmidt H, Hebebrand J: Systematic mutation screening of the pro-opiomelanocortin gene: identification of several genetic variants including three different insertions, one nonsense and two missense point mutations in probands of different weight extremes. J Clin Endocrinol Metab. 1998 Oct;83(10):3737-41. [Article]
- Echwald SM, Sorensen TI, Andersen T, Tybjaerg-Hansen A, Clausen JO, Pedersen O: Mutational analysis of the proopiomelanocortin gene in Caucasians with early onset obesity. Int J Obes Relat Metab Disord. 1999 Mar;23(3):293-8. [Article]
- Miraglia del Giudice E, Cirillo G, Santoro N, D'Urso L, Carbone MT, Di Toro R, Perrone L: Molecular screening of the proopiomelanocortin (POMC ) gene in Italian obese children: report of three new mutations. Int J Obes Relat Metab Disord. 2001 Jan;25(1):61-7. [Article]
- Challis BG, Pritchard LE, Creemers JW, Delplanque J, Keogh JM, Luan J, Wareham NJ, Yeo GS, Bhattacharyya S, Froguel P, White A, Farooqi IS, O'Rahilly S: A missense mutation disrupting a dibasic prohormone processing site in pro-opiomelanocortin (POMC) increases susceptibility to early-onset obesity through a novel molecular mechanism. Hum Mol Genet. 2002 Aug 15;11(17):1997-2004. [Article]