Ig kappa chain V-III region GOL
Details
- Name
- Ig kappa chain V-III region GOL
- Synonyms
- Rheumatoid factor
- Gene Name
- Not Available
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0016152|Ig kappa chain V-III region GOL EIVLTQSPGTLSLSPGERATLSCRAALLSSRGYLAWYQQKPGQAPRLLMYGASSRATGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPRSFGQGTKVEIKR
- Number of residues
- 109
- Molecular Weight
- 11830.17
- Theoretical pI
- 9.48
- GO Classification
- Functionsantigen bindingProcessescomplement activation / complement activation, classical pathway / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response / innate immune response / receptor-mediated endocytosis / regulation of immune responseComponentsextracellular exosome / extracellular region / extracellular space / plasma membrane
- General Function
- Antigen binding
- Specific Function
- Not Available
- Pfam Domain Function
- V-set (PF07686)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P01619 UniProtKB Entry Name KV307_HUMAN - General References
- Newkirk M, Chen PP, Carson D, Posnett D, Capra JD: Amino acid sequence of a light chain variable region of a human rheumatoid factor of the Wa idiotypic group, in part predicted by its reactivity with antipeptide antibodies. Mol Immunol. 1986 Mar;23(3):239-44. [Article]