Ig kappa chain V-III region GOL

Details

Name
Ig kappa chain V-III region GOL
Synonyms
  • Rheumatoid factor
Gene Name
Not Available
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016152|Ig kappa chain V-III region GOL
EIVLTQSPGTLSLSPGERATLSCRAALLSSRGYLAWYQQKPGQAPRLLMYGASSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPRSFGQGTKVEIKR
Number of residues
109
Molecular Weight
11830.17
Theoretical pI
9.48
GO Classification
Functions
antigen binding
Processes
complement activation / complement activation, classical pathway / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response / innate immune response / receptor-mediated endocytosis / regulation of immune response
Components
extracellular exosome / extracellular region / extracellular space / plasma membrane
General Function
Antigen binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP01619
UniProtKB Entry NameKV307_HUMAN
General References
  1. Newkirk M, Chen PP, Carson D, Posnett D, Capra JD: Amino acid sequence of a light chain variable region of a human rheumatoid factor of the Wa idiotypic group, in part predicted by its reactivity with antipeptide antibodies. Mol Immunol. 1986 Mar;23(3):239-44. [PubMed:3086710]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails