Ig gamma-2 chain C region

Details

Name
Ig gamma-2 chain C region
Synonyms
Not Available
Gene Name
IGHG2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017230|Ig gamma-2 chain C region
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR
VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN
QVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK
Number of residues
326
Molecular Weight
35900.445
Theoretical pI
7.66
GO Classification
Functions
antigen binding / immunoglobulin receptor binding
Processes
B cell receptor signaling pathway / complement activation / complement activation, classical pathway / defense response to bacterium / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / innate immune response / phagocytosis, engulfment / phagocytosis, recognition / positive regulation of B cell activation / receptor-mediated endocytosis
Components
blood microparticle / external side of plasma membrane / extracellular exosome / extracellular region / extracellular space / immunoglobulin complex, circulating
General Function
Immunoglobulin receptor binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Chromosome Location
Not Available
Locus
14q32.33
External Identifiers
ResourceLink
UniProtKB IDP01859
UniProtKB Entry NameIGHG2_HUMAN
GenBank Gene IDAL928742
HGNC IDHGNC:5526
General References
  1. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [Article]
  2. Ellison J, Hood L: Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes. Proc Natl Acad Sci U S A. 1982 Mar;79(6):1984-8. [Article]
  3. Takahashi N, Ueda S, Obata M, Nikaido T, Nakai S, Honjo T: Structure of human immunoglobulin gamma genes: implications for evolution of a gene family. Cell. 1982 Jun;29(2):671-9. [Article]
  4. Krawinkel U, Rabbitts TH: Comparison of the hinge-coding segments in human immunoglobulin gamma heavy chain genes and the linkage of the gamma 2 and gamma 4 subclass genes. EMBO J. 1982;1(4):403-7. [Article]
  5. Wang AC, Tung E, Fudenberg HH: The primary structure of a human IgG2 heavy chain: genetic, evolutionary, and functional implications. J Immunol. 1980 Sep;125(3):1048-54. [Article]
  6. Connell GE, Parr DM, Hofmann T: The amino acid sequences of the three heavy chain constant region domains of a human IgG2 myeloma protein. Can J Biochem. 1979 Jun;57(6):758-67. [Article]
  7. Hofmann T, Parr DM: A note of the amino acid sequence of residues 381--391 of human immunoglobulins gamma chains. Mol Immunol. 1979 Nov;16(11):923-5. [Article]
  8. Stoppini M, Bellotti V, Negri A, Merlini G, Garver F, Ferri G: Characterization of the two unique human anti-flavin monoclonal immunoglobulins. Eur J Biochem. 1995 Mar 15;228(3):886-93. [Article]
  9. Milstein C, Frangione B: Disulphide bridges of the heavy chain of human immunoglobulin G2. Biochem J. 1971 Jan;121(2):217-25. [Article]
  10. Frangione B, Milstein C, Pink JR: Structural studies of immunoglobulin G. Nature. 1969 Jan 11;221(5176):145-8. [Article]
  11. Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [Article]
  12. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
  13. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB073291-[N-4'-NITROBENZYL-N-4'-CARBOXYBUTYLAMINO]METHYLPHOSPHONIC ACIDexperimentalunknownDetails
DB02854AetiocholanoloneexperimentalunknownDetails
DB07375EtiocholanedioneexperimentalunknownDetails
DB04688MethylecgonineexperimentalunknownDetails
DB083233-OXO-N-[(3S)-2-OXOPYRROLIDIN-3-YL]DODECANAMIDEexperimentalunknownDetails
DB084094-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINEexperimentalunknownDetails
DB085105-ALPHA-PREGNANE-3-BETA-OL-HEMISUCCINATEexperimentalunknownDetails
DB08547PROGESTERONE-11-ALPHA-OL-HEMISUCCINATEexperimentalunknownDetails
DB086183-(HYDROXY-PHENYL-PHOSPHINOYLOXY)-8-METHYL-8-AZA-BICYCLO[3.2.1]OCTANE-2-CARBOXYLIC ACID METHYL ESTERexperimentalunknownDetails
DB15258Imlifidaseapproved, investigationalyescleavageDetails