HLA class II histocompatibility antigen, DQ beta 1 chain

Details

Name
HLA class II histocompatibility antigen, DQ beta 1 chain
Synonyms
  • HLA-DQB
  • MHC class II antigen DQB1
Gene Name
HLA-DQB1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009387|HLA class II histocompatibility antigen, DQ beta 1 chain
MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVT
RYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELR
TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLI
RNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH
Number of residues
261
Molecular Weight
29991.02
Theoretical pI
Not Available
GO Classification
Functions
MHC class II receptor activity / peptide antigen binding
Processes
antigen processing and presentation of exogenous peptide antigen via MHC class II / cytokine-mediated signaling pathway / humoral immune response mediated by circulating immunoglobulin / immune response / immunoglobulin production involved in immunoglobulin mediated immune response / interferon-gamma-mediated signaling pathway / T cell costimulation / T cell receptor signaling pathway
Components
clathrin-coated endocytic vesicle membrane / endocytic vesicle membrane / endosome membrane / ER to Golgi transport vesicle membrane / Golgi membrane / integral component of lumenal side of endoplasmic reticulum membrane / lysosomal membrane / membrane / MHC class II protein complex / plasma membrane / trans-Golgi network membrane / transport vesicle membrane
General Function
Peptide antigen binding
Specific Function
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
Pfam Domain Function
Transmembrane Regions
231-251
Cellular Location
Cell membrane
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP01920
UniProtKB Entry NameDQB1_HUMAN
HGNC IDHGNC:4944
General References
  1. Larhammar D, Andersson G, Andersson M, Bill P, Bohme J, Claesson L, Denaro M, Emmoth E, Gustafsson K, Hammarling U, et al.: Molecular analysis of human class II transplantation antigens and their genes. Hum Immunol. 1983 Sep;8(1):95-103. [PubMed:6415003]
  2. Larhammar D, Schenning L, Gustafsson K, Wiman K, Claesson L, Rask L, Peterson PA: Complete amino acid sequence of an HLA-DR antigen-like beta chain as predicted from the nucleotide sequence: similarities with immunoglobulins and HLA-A, -B, and -C antigens. Proc Natl Acad Sci U S A. 1982 Jun;79(12):3687-91. [PubMed:6954511]
  3. Larhammar D, Hyldig-Nielsen JJ, Servenius B, Andersson G, Rask L, Peterson PA: Exon-intron organization and complete nucleotide sequence of a human major histocompatibility antigen DC beta gene. Proc Natl Acad Sci U S A. 1983 Dec;80(23):7313-7. [PubMed:6316358]
  4. Boss JM, Strominger JL: Cloning and sequence analysis of the human major histocompatibility complex gene DC-3 beta. Proc Natl Acad Sci U S A. 1984 Aug;81(16):5199-203. [PubMed:6206493]
  5. Tonnelle C, DeMars R, Long EO: DO beta: a new beta chain gene in HLA-D with a distinct regulation of expression. EMBO J. 1985 Nov;4(11):2839-47. [PubMed:2998758]
  6. Turco E, Care A, Compagnone-Post P, Robinson C, Cascino I, Trucco M: Allelic forms of the alpha- and beta-chain genes encoding DQw1-positive heterodimers. Immunogenetics. 1987;26(4-5):282-90. [PubMed:2888727]
  7. Jonsson AK, Hyldig-Nielsen JJ, Servenius B, Larhammar D, Andersson G, Jorgensen F, Peterson PA, Rask L: Class II genes of the human major histocompatibility complex. Comparisons of the DQ and DX alpha and beta genes. J Biol Chem. 1987 Jun 25;262(18):8767-77. [PubMed:3036828]
  8. Schiffenbauer J, Didier DK, Klearman M, Rice K, Shuman S, Tieber VL, Kittlesen DJ, Schwartz BD: Complete sequence of the HLA DQ alpha and DQ beta cDNA from a DR5/DQw3 cell line. J Immunol. 1987 Jul 1;139(1):228-33. [PubMed:3584986]
  9. Lock CB, So AK, Welsh KI, Parkes JD, Trowsdale J: MHC class II sequences of an HLA-DR2 narcoleptic. Immunogenetics. 1988;27(6):449-55. [PubMed:3259543]
  10. Giorda R, Turco E, Trucco M: Full length beta chain cDNAs of DQw9 and DQw8 molecules encode proteins that differ only at amino acid 57. Immunogenetics. 1991;33(5-6):404-8. [PubMed:2050393]
  11. Vilches C, Garcia-Pacheco JM, de Pablo R, Puente S, Kreisler M: Complete coding region of the new HLA-DQB1*0612 allele, obtained by RT-PCR. Tissue Antigens. 1996 Nov;48(5):589-92. [PubMed:8988543]
  12. Ellis MC, Hetisimer AH, Ruddy DA, Hansen SL, Kronmal GS, McClelland E, Quintana L, Drayna DT, Aldrich MS, Mignot E: HLA class II haplotype and sequence analysis support a role for DQ in narcolepsy. Immunogenetics. 1997;46(5):410-7. [PubMed:9271631]
  13. Raymond CK, Kas A, Paddock M, Qiu R, Zhou Y, Subramanian S, Chang J, Palmieri A, Haugen E, Kaul R, Olson MV: Ancient haplotypes of the HLA Class II region. Genome Res. 2005 Sep;15(9):1250-7. [PubMed:16140993]
  14. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  15. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  16. Hiraiwa A, Seyfried CE, Nepom GT, Milner EC: Sequence analysis of HLA class II domains: characterization of the DQw3 family of DQB genes. Immunogenetics. 1989;29(3):186-90. [PubMed:2925231]
  17. Uryu N, Maeda M, Nagata Y, Matsuki K, Juji T, Honda Y, Kawai J, Ando A, Tsuji K, Inoko H: No difference in the nucleotide sequence of the DQ beta beta 1 domain between narcoleptic and healthy individuals with DR2,Dw2. Hum Immunol. 1989 Mar;24(3):175-81. [PubMed:2494138]
  18. Jonsson AK, Andersson L, Rask L: Complete sequences of DQA1 and DQB1 cDNA clones corresponding to the DQw4 specificity. Immunogenetics. 1989;30(3):232-4. [PubMed:2777341]
  19. Yasunaga S, Kimura A, Hamaguchi K, Ronningen KS, Sasazuki T: Different contribution of HLA-DR and -DQ genes in susceptibility and resistance to insulin-dependent diabetes mellitus (IDDM). Tissue Antigens. 1996 Jan;47(1):37-48. [PubMed:8929711]
  20. Balas A, Santos S, Aviles MJ, Garcia-Sanchez F, Lillo R, Vicario JL: Identification by sequencing based typing and complete coding region analysis of three new HLA class II alleles: DRB3*0210, DRB3*0211 and DQB1*0310. Tissue Antigens. 2000 Oct;56(4):380-4. [PubMed:11098940]
  21. Cucca F, Frau F, Lampis R, Floris M, Argiolas L, Macis D, Cao A, De Virgiliis S, Congia M: HLA-DQB1*0305 and -DQB1*0304 alleles among Sardinians. Evolutionary and practical implications for oligotyping. Hum Immunol. 1994 Jun;40(2):143-9. [PubMed:7928445]
  22. Gotz H, Kratzin H, Thinnes FP, Yang C, Kruse T, Pauly E, Kolbel S, Egert G, Wernet P, Hilschmann N: Primary structure of human class II histocompatibility antigens 3rd communication. Amino acid sequence comparison between DR and DC subclass antigens derived from a lymphoblastoid B cell line homozygous at the HLA loci (HLA-A3,3; B7,7; Dw2,2; DR2,2: MT1,1; Dc1,1: MB1,1). Hoppe Seylers Z Physiol Chem. 1983 Jun;364(6):749-55. [PubMed:6576979]
  23. Lee KW, Johnson AH, Hurley CK: Two divergent routes of evolution gave rise to the DRw13 haplotypes. J Immunol. 1990 Nov 1;145(9):3119-25. [PubMed:2212675]
  24. Karr RW, Gregersen PK, Obata F, Goldberg D, Maccari J, Alber C, Silver J: Analysis of DR beta and DQ beta chain cDNA clones from a DR7 haplotype. J Immunol. 1986 Nov 1;137(9):2886-90. [PubMed:3020127]
  25. Chang Y, Fan TX, Santana Z, Day NK: Identification of a novel allele HLA-DQB1*0622. Tissue Antigens. 2007 Nov;70(5):442-4. Epub 2007 Sep 16. [PubMed:17868257]
  26. Lee BS, Bell JI, Rust NA, McDevitt HO: Structural and functional variability among DQ beta alleles of DR2 subtypes. Immunogenetics. 1987;26(1-2):85-91. [PubMed:2886427]
  27. Thye T, Muntau B, Stelma FF, Horstmann RD: A novel allele, DQB1*0307, in a West African family. Tissue Antigens. 1997 May;49(5):517-8. [PubMed:9174147]
  28. Casamitjana N, Gil J, Campos E, Santos M, Nogues N, Ribera A, Palou E: Identification of a novel HLA-DQB1*06 allele, DQB1*0618. Tissue Antigens. 2001 Oct;58(4):269-71. [PubMed:11782280]
  29. Hsu SH, Robbins FM, Modelo RB, Brunner J, Flomenberg N: Identification of a new DQB1*0613 allele in a family. Tissue Antigens. 1997 Dec;50(6):685-7. [PubMed:9458130]
  30. Witter K, Mautner J, Albert T, Zahn R, Kauke T: HLA-DQB1*0319, a novel HLA-DQB1 allele, shows strong haplotype association to HLA-DRB1*1102. Tissue Antigens. 2007 Jul;70(1):73-5. [PubMed:17559588]
  31. Witter K, Albert T, Zahn R, Kauke T: HLA-DQB1*0634, a novel DQB1 allele found by high-resolution HLA typing of a sibling pair for potential bone marrow transplantation. Tissue Antigens. 2008 May;71(5):486-8. doi: 10.1111/j.1399-0039.2008.01021.x. Epub 2008 Mar 10. [PubMed:18331527]
  32. Lazaro AM, Xiao Y, Masaberg C, Lebeck L, Ng J, Hurley CK, Posch PE: Novel alleles at the HLA-DRB1 and -DQB1 loci. Tissue Antigens. 2008 Jul;72(1):72-4. doi: 10.1111/j.1399-0039.2008.01070.x. [PubMed:18588576]
  33. Witter K, Lochmann E, Vecchiato C, Albert T, Zahn R, Kauke T: Sequence-based HLA high-resolution retyping of a bone marrow donor/recipient pair reveals the novel HLA allele DQB1*0322. Tissue Antigens. 2009 Mar;73(3):283-5. doi: 10.1111/j.1399-0039.2008.01201.x. [PubMed:19254265]
  34. Wienzek S, Verboom M, Blasczyk R, Bein G, Horn PA: DQB1*0323 is the result of a gene conversion event between a DQB1*06 and a DQB1*030303 allele. Tissue Antigens. 2009 Jun;73(6):624-5. doi: 10.1111/j.1399-0039.2009.01231.x. Epub 2009 Mar 16. [PubMed:19493242]
  35. Mersch G, Semana G, De Canck I, Jannes G, Rombout A, Sterker G, Rossau R: Characterization of a new DQB1 allele (DQB1*0610) which differs from DQB1*0602 at the highly polymorphic 57-codon. Tissue Antigens. 1996 Sep;48(3):217-20. [PubMed:8896183]
  36. Saito S, Ota S, Hashizume K, Yamada E, Kaneshige T, Kinoshita T, Hashimoto M, Oguchi H, Ishii E, Fukushima H: A new HLA-DQB1*0306 allele sharing motifs from DQB1*03032 and DQB1*04 sequences. Tissue Antigens. 1996 Nov;48(5):580-5. [PubMed:8988541]
  37. Hogbin JP, Greville W, Chapman G, Kennedy A, Velickovic ZM, Dunckley H: Identification of two novel HLA class II alleles, DQB1*0311 and DQB1*0620. Tissue Antigens. 2004 Oct;64(4):515-7. [PubMed:15361133]
  38. Gu H, Kimm K, Lee JK, Oh B: Identification of a novel HLA-DQB1 allele, DQB1*0314, by sequence-based typing in the Korean population. Tissue Antigens. 2005 May;65(5):503-4. [PubMed:15853909]
  39. Witter K, Albert T, Zahn R, Kauke T: A novel HLA-DQB1*06 allele, DQB1*0628, found through routine sequence-based HLA typing and confirmation of DQB1*060302. Tissue Antigens. 2007 Jan;69(1):102-3. [PubMed:17212715]
  40. Emmerich F, Schonemann C, Diederich G, Horn PA, Salama A: Identification of a novel HLA-DQB1 allele, HLA-DQB1*0632. Tissue Antigens. 2008 Jan;71(1):94-5. Epub 2007 Nov 10. [PubMed:17999653]
  41. Giannoli C, Paturel L, Favre-Victoire I, Bera O, Dubois V: Two new HLA-DQB alleles routinely identified by sequence-based typing: DQB1*030103 and DQB1*0505. Tissue Antigens. 2009 Jun;73(6):622-3. doi: 10.1111/j.1399-0039.2009.01248.x. Epub 2009 Apr 12. [PubMed:19392794]
  42. Luo M, Blanchard J, Maclean I, Brunham R: Identification of a novel DQB1 allele DBQ1*0616. Tissue Antigens. 1999 Apr;53(4 Pt 1):381-2. [PubMed:10323344]
  43. Hashemi-Tavoularis S, Ouellet S, Sengar DP, Buyse IM: A novel DRB3 allele (DRB3*0208), a new allelic variant of DRB1*1502 (DRB1*15023) and two new DQB1 (DQB1*03012 and DQB1*0614) alleles. Tissue Antigens. 1998 Sep;52(3):294-9. [PubMed:9802612]
  44. Williams TM, Bassinger S, Moehlenkamp C, Wu J, Montoya GD, Griffith BB, McAuley JD, Goldman S, Maurer DH, Troup GM: Strategy for distinguishing a new DQB1 allele (DQB1*0611) from the closely related DQB1*0602 allele via sequence specific PCR or direct DNA sequencing. Tissue Antigens. 1996 Sep;48(3):143-7. [PubMed:8896171]
  45. Brixner V, Mosebach M, Schmidt M, Hermann S, Seifried E, Martin H, Seidl C: HLA-DRB1*0826 and HLA-DQB1*0627, two novel class II alleles identified in blood stem cell donors of Caucasian origin. Tissue Antigens. 2006 Feb;67(2):160-2. [PubMed:16441489]
  46. Fenske TS, Baxter-Lowe LA: Two novel HLA-DQB1*06 alleles reveal additional heterogeneity of HLA-DQw1. Tissue Antigens. 1992 Jul;40(1):49-52. [PubMed:1440562]
  47. Gyllensten UB, Lashkari D, Erlich HA: Allelic diversification at the class II DQB locus of the mammalian major histocompatibility complex. Proc Natl Acad Sci U S A. 1990 Mar;87(5):1835-9. [PubMed:2308943]
  48. Bugawan TL, Erlich HA: Rapid typing of HLA-DQB1 DNA polymorphism using nonradioactive oligonucleotide probes and amplified DNA. Immunogenetics. 1991;33(3):163-70. [PubMed:2010218]
  49. Larhammar D, Wiman K, Schenning L, Claesson L, Gustafsson K, Peterson PA, Rask L: Evolutionary relationship between HLA-DR antigen beta-chains, HLA-A, B, C antigen subunits and immunoglobulin chains. Scand J Immunol. 1981 Dec;14(6):617-22. [PubMed:6952552]
  50. Bourgin P, Zeitzer JM, Mignot E: CSF hypocretin-1 assessment in sleep and neurological disorders. Lancet Neurol. 2008 Jul;7(7):649-62. doi: 10.1016/S1474-4422(08)70140-6. [PubMed:18565458]
  51. Cresswell P: Invariant chain structure and MHC class II function. Cell. 1996 Feb 23;84(4):505-7. [PubMed:8598037]
  52. Villadangos JA: Presentation of antigens by MHC class II molecules: getting the most out of them. Mol Immunol. 2001 Sep;38(5):329-46. [PubMed:11684289]
  53. Rocha N, Neefjes J: MHC class II molecules on the move for successful antigen presentation. EMBO J. 2008 Jan 9;27(1):1-5. Epub 2007 Nov 29. [PubMed:18046453]
  54. Menendez-Benito V, Neefjes J: Autophagy in MHC class II presentation: sampling from within. Immunity. 2007 Jan;26(1):1-3. [PubMed:17241953]
  55. Berger AC, Roche PA: MHC class II transport at a glance. J Cell Sci. 2009 Jan 1;122(Pt 1):1-4. doi: 10.1242/jcs.035089. [PubMed:19092054]
  56. Beswick EJ, Reyes VE: CD74 in antigen presentation, inflammation, and cancers of the gastrointestinal tract. World J Gastroenterol. 2009 Jun 21;15(23):2855-61. [PubMed:19533806]
  57. Lee KH, Wucherpfennig KW, Wiley DC: Structure of a human insulin peptide-HLA-DQ8 complex and susceptibility to type 1 diabetes. Nat Immunol. 2001 Jun;2(6):501-7. [PubMed:11376336]
  58. Siebold C, Hansen BE, Wyer JR, Harlos K, Esnouf RE, Svejgaard A, Bell JI, Strominger JL, Jones EY, Fugger L: Crystal structure of HLA-DQ0602 that protects against type 1 diabetes and confers strong susceptibility to narcolepsy. Proc Natl Acad Sci U S A. 2004 Feb 17;101(7):1999-2004. Epub 2004 Feb 9. [PubMed:14769912]
  59. Kim CY, Quarsten H, Bergseng E, Khosla C, Sollid LM: Structural basis for HLA-DQ2-mediated presentation of gluten epitopes in celiac disease. Proc Natl Acad Sci U S A. 2004 Mar 23;101(12):4175-9. Epub 2004 Mar 12. [PubMed:15020763]
  60. Henderson KN, Tye-Din JA, Reid HH, Chen Z, Borg NA, Beissbarth T, Tatham A, Mannering SI, Purcell AW, Dudek NL, van Heel DA, McCluskey J, Rossjohn J, Anderson RP: A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease. Immunity. 2007 Jul;27(1):23-34. Epub 2007 Jul 12. [PubMed:17629515]
  61. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00071Insulin porkapprovedunknownDetails