Apolipoprotein A-II
Details
- Name
- Apolipoprotein A-II
- Synonyms
- Apo-AII
- Apolipoprotein A2
- Gene Name
- APOA2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0019032|Apolipoprotein A-II MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
- Number of residues
- 100
- Molecular Weight
- 11174.925
- Theoretical pI
- 6.59
- GO Classification
- Functionsapolipoprotein receptor binding / cholesterol binding / cholesterol transporter activity / high-density lipoprotein particle binding / high-density lipoprotein particle receptor binding / lipase inhibitor activity / lipid binding / lipid transporter activity / phosphatidylcholine binding / phosphatidylcholine-sterol O-acyltransferase activator activity / phospholipid binding / protein heterodimerization activity / protein homodimerization activityProcessesacute inflammatory response / cellular lipid metabolic process / cholesterol efflux / cholesterol homeostasis / cholesterol metabolic process / diacylglycerol catabolic process / high-density lipoprotein particle assembly / high-density lipoprotein particle clearance / high-density lipoprotein particle remodeling / lipoprotein metabolic process / low-density lipoprotein particle remodeling / negative regulation of cholesterol import / negative regulation of cholesterol transport / negative regulation of cholesterol transporter activity / negative regulation of cytokine secretion involved in immune response / negative regulation of lipase activity / negative regulation of lipid catabolic process / negative regulation of very-low-density lipoprotein particle remodeling / organ regeneration / peptidyl-methionine modification / phosphatidylcholine biosynthetic process / phospholipid catabolic process / phospholipid efflux / phototransduction, visible light / positive regulation of catalytic activity / positive regulation of cholesterol esterification / positive regulation of interleukin-8 biosynthetic process / positive regulation of lipid catabolic process / protein folding / protein oxidation / regulation of intestinal cholesterol absorption / regulation of protein stability / response to drug / response to estrogen / response to glucocorticoid / response to glucose / retinoid metabolic process / reverse cholesterol transport / small molecule metabolic process / triglyceride metabolic process / triglyceride-rich lipoprotein particle remodeling / viral processComponentsblood microparticle / chylomicron / cytosol / early endosome / endoplasmic reticulum lumen / extracellular exosome / extracellular region / high-density lipoprotein particle / spherical high-density lipoprotein particle / very-low-density lipoprotein particle
- General Function
- Protein homodimerization activity
- Specific Function
- May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.
- Pfam Domain Function
- ApoA-II (PF04711)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0019033|Apolipoprotein A-II (APOA2) ATGAAGCTGCTCGCAGCAACTGTGCTACTCCTCACCATCTGCAGCCTTGAAGGAGCTTTG GTTCGGAGACAGGCAAAGGAGCCATGTGTGGAGAGCCTGGTTTCTCAGTACTTCCAGACC GTGACTGACTATGGCAAGGACCTGATGGAGAAGGTCAAGAGCCCAGAGCTTCAGGCCGAG GCCAAGTCTTACTTTGAAAAGTCAAAGGAGCAGCTGACACCCCTGATCAAGAAGGCTGGA ACGGAACTGGTTAACTTCTTGAGCTATTTCGTGGAACTTGGAACACAGCCTGCCACCCAG TGA
- Chromosome Location
- 1
- Locus
- 1q21-q23
- External Identifiers
Resource Link UniProtKB ID P02652 UniProtKB Entry Name APOA2_HUMAN GenBank Protein ID 28748 GenBank Gene ID X00955 GenAtlas ID APOA2 HGNC ID HGNC:601 - General References
- Knott TJ, Priestley LM, Urdea M, Scott J: Isolation and characterisation of a cDNA encoding the precursor for human apolipoprotein AII. Biochem Biophys Res Commun. 1984 May 16;120(3):734-40. [Article]
- Moore MN, Kao FT, Tsao YK, Chan L: Human apolipoprotein A-II: nucleotide sequence of a cloned cDNA, and localization of its structural gene on human chromosome 1. Biochem Biophys Res Commun. 1984 Aug 30;123(1):1-7. [Article]
- Sharpe CR, Sidoli A, Shelley CS, Lucero MA, Shoulders CC, Baralle FE: Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance. Nucleic Acids Res. 1984 May 11;12(9):3917-32. [Article]
- Lackner KJ, Law SW, Brewer HB Jr: The human apolipoprotein A-II gene: complete nucleic acid sequence and genomic organization. Nucleic Acids Res. 1985 Jun 25;13(12):4597-608. [Article]
- Knott TJ, Wallis SC, Robertson ME, Priestley LM, Urdea M, Rall LB, Scott J: The human apolipoprotein AII gene: structural organization and sites of expression. Nucleic Acids Res. 1985 Sep 11;13(17):6387-98. [Article]
- Chan L, Moore MN, Tsao YK: Molecular cloning and sequence analysis of human apolipoprotein A-II cDNA. Methods Enzymol. 1986;128:745-52. [Article]
- Fullerton SM, Clark AG, Weiss KM, Taylor SL, Stengard JH, Salomaa V, Boerwinkle E, Nickerson DA: Sequence polymorphism at the human apolipoprotein AII gene ( APOA2): unexpected deficit of variation in an African-American sample. Hum Genet. 2002 Jul;111(1):75-87. Epub 2002 Jun 14. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Lux SE, John KM, Ronan R, Brewer HB Jr: Isolation and characterization of the tryptic and cyanogen bromide peptides of apoLp-Gln-II (apoA-II), plasma high density apolipoprotein. J Biol Chem. 1972 Dec 10;247(23):7519-27. [Article]
- Su M, Qi Y, Wang M, Chang W, Peng S, Xu T, Wang D: Expression and purification of recombinant human apolipoprotein A-II in Pichia pastoris. Assay Drug Dev Technol. 2013 Oct;11(8):501-7. doi: 10.1089/adt.2013.511. Epub 2013 Oct 12. [Article]
- Stoffel W, Kruger E, Deutzmann R: Cell-free translation of human liver apolipoprotein AI and AII mRNA. Processing of primary translation products. Hoppe Seylers Z Physiol Chem. 1983 Mar;364(3):227-37. [Article]
- Deeb SS, Takata K, Peng RL, Kajiyama G, Albers JJ: A splice-junction mutation responsible for familial apolipoprotein A-II deficiency. Am J Hum Genet. 1990 Apr;46(4):822-7. [Article]
- Yang CY, Gu ZW, Blanco-Vaca F, Gaskell SJ, Yang M, Massey JB, Gotto AM Jr, Pownall HJ: Structure of human apolipoprotein D: locations of the intermolecular and intramolecular disulfide links. Biochemistry. 1994 Oct 18;33(41):12451-5. [Article]
- Ritter M, Buechler C, Boettcher A, Barlage S, Schmitz-Madry A, Orso E, Bared SM, Schmiedeknecht G, Baehr CH, Fricker G, Schmitz G: Cloning and characterization of a novel apolipoprotein A-I binding protein, AI-BP, secreted by cells of the kidney proximal tubules in response to HDL or ApoA-I. Genomics. 2002 May;79(5):693-702. [Article]
- Pankhurst G, Wang XL, Wilcken DE, Baernthaler G, Panzenbock U, Raftery M, Stocker R: Characterization of specifically oxidized apolipoproteins in mildly oxidized high density lipoprotein. J Lipid Res. 2003 Feb;44(2):349-55. Epub 2002 Nov 4. [Article]
- Niederkofler EE, Tubbs KA, Kiernan UA, Nedelkov D, Nelson RW: Novel mass spectrometric immunoassays for the rapid structural characterization of plasma apolipoproteins. J Lipid Res. 2003 Mar;44(3):630-9. Epub 2002 Dec 1. [Article]
- Hunter M, Angelicheva D, Tournev I, Ingley E, Chan DC, Watts GF, Kremensky I, Kalaydjieva L: NDRG1 interacts with APO A-I and A-II and is a functional candidate for the HDL-C QTL on 8q24. Biochem Biophys Res Commun. 2005 Jul 15;332(4):982-92. [Article]
- Zhou W, Ross MM, Tessitore A, Ornstein D, Vanmeter A, Liotta LA, Petricoin EF 3rd: An initial characterization of the serum phosphoproteome. J Proteome Res. 2009 Dec;8(12):5523-31. doi: 10.1021/pr900603n. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Halim A, Ruetschi U, Larson G, Nilsson J: LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins. J Proteome Res. 2013 Feb 1;12(2):573-84. doi: 10.1021/pr300963h. Epub 2013 Jan 11. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028. [Article]
- Kumar MS, Carson M, Hussain MM, Murthy HM: Structures of apolipoprotein A-II and a lipid-surrogate complex provide insights into apolipoprotein-lipid interactions. Biochemistry. 2002 Oct 1;41(39):11681-91. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB09130 Copper approved, investigational unknown Details DB01593 Zinc approved, investigational unknown Details DB14487 Zinc acetate approved, investigational unknown Details DB11886 Infigratinib approved, investigational no binder Details DB00877 Sirolimus approved, investigational no binder Details