Alpha-fetoprotein

Details

Name
Alpha-fetoprotein
Synonyms
  • Alpha-1-fetoprotein
  • Alpha-fetoglobulin
Gene Name
Afp
Organism
Rat
Amino acid sequence
>lcl|BSEQ0051616|Alpha-fetoprotein
MKQPATMKWSASISFLLLLNFAEPRVLHTNEFGIESTLDSSQCPTEKNMFNVATIVVAQF
VQDATKAEVNKMSSDALAAMKENTGDGCLENQLSVFLDEICHETELSNKYGFSGCCNQSG
VERHQCLLARKKTAPDSVPPFHFPETAESCPAYEENRAMSINTFIYDVSKRNPFLYAPTI
LYLAAQYDKAVPACCKADNMEECFQTKRASMAKELREGSMLNEHVCAVIRKFGSRNLQAV
LIIKLSQKFPKANITEIRKLALDVAHIHEQCCHGNAMECLQDGESVMTHMCSQQEILSSK
TAECCKLPTIELGYCIIHAENGDKPEGLTLNPSEFLGDRNFAQFSSEEKLLFMASFLHEY
SRNHPNLPVSVILKTAKSYQEILEKCSQSETPSKCQDNMEEELQKHIQESQALAKQSCNL
YQKLGPYYLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCCQLSEEKRSACGEGLAD
IYIGHLCLRHEANPVNSGINHCCSSSYSNRRLCITSFLRDETYVPPPFSEDKFIFHKDLC
QAQGRALQTMKQELLINLVKQKPEMTEEQHAAVTADFSGLLEKCCKDQDQEACFAKEGPK
LISKTREALGV
Number of residues
611
Molecular Weight
68385.48
Theoretical pI
Not Available
GO Classification
Functions
metal ion binding
Processes
animal organ regeneration / liver development / ovulation from ovarian follicle / pancreas development / progesterone metabolic process / response to organic substance / sexual reproduction / SMAD protein signal transduction
Components
cytoplasm / extracellular space
General Function
Binds estrogens, fatty acids and metals.
Specific Function
Metal ion binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP02773
UniProtKB Entry NameFETA_RAT
General References
  1. Watanabe T, Jimenez-Molina JL, Chou JY: Characterization of a rat variant alpha-fetoprotein. Biochem Biophys Res Commun. 1992 Jun 15;185(2):648-56. [PubMed:1376990]
  2. Turcotte B, Guertin M, Chevrette M, Belanger L: Rat alpha 1-fetoprotein messenger RNA: 5'-end sequence and glucocorticoid-suppressed liver transcription in an improved nuclear run-off assay. Nucleic Acids Res. 1985 Apr 11;13(7):2387-98. [PubMed:2582363]
  3. Jagodzinski LL, Sargent TD, Yang M, Glackin C, Bonner J: Sequence homology between RNAs encoding rat alpha-fetoprotein and rat serum albumin. Proc Natl Acad Sci U S A. 1981 Jun;78(6):3521-5. [PubMed:6167988]
  4. Buzard G, Locker J: The transcription control region of the rat alpha-fetoprotein gene. DNA sequence and homology studies. DNA Seq. 1990;1(1):33-48. [PubMed:1722723]
  5. Chevrette M, Guertin M, Turcotte B, Belanger L: The rat alpha 1-fetoprotein gene: characterization of the 5'-flanking region and tandem organization with the albumin gene. Nucleic Acids Res. 1987 Feb 11;15(3):1338-9. [PubMed:2434929]
  6. Nahon JL, Danan JL, Poiret M, Tratner I, Jose-Estanyol M, Sala-Trepat JM: The rat alpha-fetoprotein and albumin genes. Transcriptional control and comparison of the sequence organization and promoter region. J Biol Chem. 1987 Sep 15;262(26):12479-87. [PubMed:2442163]
  7. Innis MA, Miller DL: alpha-Fetoprotein gene expression. Partial DNA sequence and COOH-terminal homology to albumin. J Biol Chem. 1980 Oct 10;255(19):8994-6. [PubMed:6157690]
  8. Liao WS, Hamilton RW, Taylor JM: Amino acid sequence homology between rat alpha-fetoprotein and albumin at the COOH-terminal regions. J Biol Chem. 1980 Sep 10;255(17):8046-9. [PubMed:6157681]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11221DioxybenzoneapprovedunknownbinderDetails