Thymidine kinase

Details

Name
Thymidine kinase
Synonyms
  • 2.7.1.21
Gene Name
TK
Organism
HHV-1
Amino acid sequence
>lcl|BSEQ0010984|Thymidine kinase
MASYPCHQHASAFDQAARSRGHNNRRTALRPRRQQEATEVRPEQKMPTLLRVYIDGPHGM
GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVV
MTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDRHPIAALLCYPAARYLMG
SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYG
LLANTVRYLQCGGSWREDWGQLSGTAVPPQGAEPQSNAGPRPHIGDTLFTLFRAPELLAP
NGDLYNVFAWALDVLAKRLRSMHVFILDYDQSPAGCRDALLQLTSGMVQTHVTTPGSIPT
ICDLARTFAREMGEAN
Number of residues
376
Molecular Weight
40971.555
Theoretical pI
7.96
GO Classification
Functions
ATP binding / thymidine kinase activity
Processes
DNA biosynthetic process / TMP biosynthetic process
General Function
Thymidine kinase activity
Specific Function
In latent infection, may allow the virus to be reactivated and to grow in cells lacking a high concentration of phosphorylated nucleic acid precursors, such as nerve cells that do not replicate their genome.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0010985|Thymidine kinase (TK)
ATGGCTTCGTACCCCTGCCATCAACACGCGTCTGCGTTCGACCAGGCTGCGCGTTCTCGC
GGCCATAACAACCGACGTACGGCGTTGCGCCCTCGCCGGCAGCAAAAAGCCACGGAAGTC
CGCCTGGAGCAGAAAATGCCCACGCTACTGCGGGTTTATATAGACGGTCCCCACGGGATG
GGGAAAACCACCACCACGCAACTGCTGGTGGCCCTGGGTTCGCGCGACGATATCGTCTAC
GTACCCGAGCCGATGACTTACTGGCGGGTGTTGGGGGCTTCCGAGACAATCGCGAACATC
TACACCACACAACACCGCCTCGACCAGGGTGAGATATCGGCCGGGGACGCGGCGGTGGTA
ATGACAAGCGCCCAGATAACAATGGGCATGCCTTATGCCGTGACCGACGCCGTTCTGGCT
CCTCATATCGGGGGGGAGGCTGGGAGCTCACATGCCCCGCCCCCGGCCCTCACCCTCATC
TTCGACCGCCATCCCATCGCCGCCCTCCTGTGCTACCCGGCCGCGCGATACCTTATGGGC
AGCATGACCCCCCAGGCCGTGCTGGCGTTCGTGGCCCTCATCCCGCCGACCTTGCCCGGC
ACAAACATCGTGTTGGGGGCCCTTCCGGAGGACAGACACATCGACCGCCTGGCCAAACGC
CAGCGCCCCGGCGAGCGGCTTGACCTGGCTATGCTGGCCGCGATTCGCCGCGTTTATGGG
CTGCTTGCCAATACGGTGCGGTATCTGCAGGGCGGCGGGTCGTGGCGGGAGGATTGGGGA
CAGCTTTCGGGGGCGGCCGTGCCGCCCCAGGGTGCCGAGCCCCAGAGCAACGCGGGCCCA
CGACCCCATATCGGGGACACGTTATTTACCCTGTTTCGGGCCCCCGAGTTGCTGGCCCCC
AACGGCGACCTGTATAACGTGTTTGCCTGGGCTTTGGACGTCTTGGCCAAACGCCTCCGT
CCCATGCACGTCTTTATCCTGGATTACGACCAATCGCCCGCCGGCTGCCGGGACGCCCTG
CTGCAACTTACCTCCGGGATGGTCCAGACCCACGTCACCACCCCAGGCTCCATACCGACG
ATCTGCGACCTGGCGCGCACGTTTGCCCGGGAGATGGGGGAGGCTAACTGA
Chromosome Location
Not Available
Locus
-
External Identifiers
ResourceLink
UniProtKB IDP03176
UniProtKB Entry NameKITH_HHV11
GenBank Protein ID59524
GenBank Gene IDX14112
General References
  1. McKnight SL: The nucleotide sequence and transcript map of the herpes simplex virus thymidine kinase gene. Nucleic Acids Res. 1980 Dec 20;8(24):5949-64. [PubMed:6258156]
  2. McGeoch DJ, Dalrymple MA, Davison AJ, Dolan A, Frame MC, McNab D, Perry LJ, Scott JE, Taylor P: The complete DNA sequence of the long unique region in the genome of herpes simplex virus type 1. J Gen Virol. 1988 Jul;69 ( Pt 7):1531-74. [PubMed:2839594]
  3. Wild K, Bohner T, Aubry A, Folkers G, Schulz GE: The three-dimensional structure of thymidine kinase from herpes simplex virus type 1. FEBS Lett. 1995 Jul 17;368(2):289-92. [PubMed:7628623]
  4. Brown DG, Visse R, Sandhu G, Davies A, Rizkallah PJ, Melitz C, Summers WC, Sanderson MR: Crystal structures of the thymidine kinase from herpes simplex virus type-1 in complex with deoxythymidine and ganciclovir. Nat Struct Biol. 1995 Oct;2(10):876-81. [PubMed:7552712]
  5. Wild K, Bohner T, Folkers G, Schulz GE: The structures of thymidine kinase from herpes simplex virus type 1 in complex with substrates and a substrate analogue. Protein Sci. 1997 Oct;6(10):2097-106. [PubMed:9336833]
  6. Champness JN, Bennett MS, Wien F, Visse R, Summers WC, Herdewijn P, de Clerq E, Ostrowski T, Jarvest RL, Sanderson MR: Exploring the active site of herpes simplex virus type-1 thymidine kinase by X-ray crystallography of complexes with aciclovir and other ligands. Proteins. 1998 Aug 15;32(3):350-61. [PubMed:9715911]
  7. Bennett MS, Wien F, Champness JN, Batuwangala T, Rutherford T, Summers WC, Sun H, Wright G, Sanderson MR: Structure to 1.9 A resolution of a complex with herpes simplex virus type-1 thymidine kinase of a novel, non-substrate inhibitor: X-ray crystallographic comparison with binding of aciclovir. FEBS Lett. 1999 Jan 25;443(2):121-5. [PubMed:9989588]
  8. Vogt J, Perozzo R, Pautsch A, Prota A, Schelling P, Pilger B, Folkers G, Scapozza L, Schulz GE: Nucleoside binding site of herpes simplex type 1 thymidine kinase analyzed by X-ray crystallography. Proteins. 2000 Dec 1;41(4):545-53. [PubMed:11056041]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01643Thymidine monophosphateexperimentalunknownDetails
DB023245-Iodo-2'-Deoxyuridine-5'-MonophosphateexperimentalunknownDetails
DB024959-(4-hydroxybutyl)-N2-phenylguanineexperimentalunknownDetails
DB025006-(Dihydroxy-Isobutyl)-ThymineexperimentalunknownDetails
DB02765R-9-(2-hydroxypropyl)adenineexperimentalunknownDetails
DB02921(South)-Methanocarba-ThymidineexperimentalunknownDetails
DB03000S-9-(2-hydroxypropyl)adenineexperimentalunknownDetails
DB03280P1-(5'-Adenosyl)P5-(5'-Thymidyl)PentaphosphateexperimentalunknownDetails
DB03312Brivudineapproved, investigationalunknownDetails
DB038045-BromothienyldeoxyuridineexperimentalunknownDetails
DB041396-HydroxypropylthymineexperimentalunknownDetails
DB04485Thymidineexperimental, investigationalunknownDetails
DB00787AcyclovirapprovedyespotentiatorDetails
DB01004Ganciclovirapproved, investigationalyesinducerDetails