C4b-binding protein alpha chain

Details

Name
C4b-binding protein alpha chain
Synonyms
  • C4BP
  • Proline-rich protein
  • PRP
Gene Name
C4BPA
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049812|C4b-binding protein alpha chain
MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAA
PMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELR
NGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPD
IRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCR
KPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCI
NLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGC
EALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP
SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQC
KALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEW
ETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Number of residues
597
Molecular Weight
67032.63
Theoretical pI
Not Available
GO Classification
Functions
RNA binding
Processes
complement activation, classical pathway / innate immune response / negative regulation of complement activation, classical pathway / positive regulation of protein catabolic process / regulation of complement activation / regulation of opsonization
Components
blood microparticle / extracellular region / extracellular space / other organism cell / plasma membrane
General Function
Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.
Specific Function
Rna binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049813|C4b-binding protein alpha chain (C4BPA)
ATGCACCCCCCAAAAACTCCATCTGGGGCTCTTCATAGAAAAAGGAAAATGGCAGCCTGG
CCCTTCTCCAGGCTGTGGAAAGTCTCTGATCCAATTCTCTTCCAAATGACCTTGATCGCT
GCTCTGTTGCCTGCTGTTCTTGGCAATTGTGGTCCTCCACCCACTTTATCATTTGCTGCC
CCGATGGATATTACGTTGACTGAGACACGCTTCAAAACTGGAACTACTCTGAAATACACC
TGCCTCCCTGGCTACGTCAGATCCCATTCAACTCAGACGCTTACCTGTAATTCTGATGGC
GAATGGGTGTATAACACCTTCTGTATCTACAAACGATGCAGACACCCAGGAGAGTTACGT
AATGGGCAAGTAGAGATTAAGACAGATTTATCTTTTGGATCACAAATAGAATTCAGCTGT
TCAGAAGGATTTTTCTTAATTGGCTCAACCACTAGTCGTTGTGAAGTCCAAGATAGAGGA
GTTGGCTGGAGTCATCCTCTCCCACAATGTGAAATTGTCAAGTGTAAGCCTCCTCCAGAC
ATCAGGAATGGAAGGCACAGCGGTGAAGAAAATTTCTACGCATACGGCTTTTCTGTCACC
TACAGCTGTGACCCCCGCTTCTCACTCTTGGGCCATGCCTCCATTTCTTGCACTGTGGAG
AATGAAACAATAGGTGTTTGGAGACCAAGCCCTCCTACCTGTGAAAAAATCACCTGTCGC
AAGCCAGATGTTTCACATGGGGAAATGGTCTCTGGATTTGGACCCATCTATAATTACAAA
GACACTATTGTGTTTAAGTGCCAAAAAGGTTTTGTTCTCAGAGGCAGCAGTGTAATTCAT
TGTGATGCTGATAGCAAATGGAATCCTTCTCCTCCTGCTTGTGAGCCCAATAGTTGTATT
AATTTACCAGACATTCCACATGCTTCCTGGGAAACATATCCTAGGCCGACAAAAGAGGAT
GTGTATGTTGTTGGGACTGTGTTAAGGTACCGCTGTCATCCTGGCTACAAACCCACTACA
GATGAGCCTACGACTGTGATTTGTCAGAAAAATTTGAGATGGACCCCATACCAAGGATGT
GAGGCGTTATGTTGCCCTGAACCAAAGCTAAATAATGGTGAAATCACTCAACACAGGAAA
AGTCGTCCTGCCAATCACTGTGTTTATTTCTATGGAGATGAGATTTCATTTTCATGTCAT
GAGACCAGTAGGTTTTCAGCTATATGCCAAGGAGATGGCACGTGGAGTCCCCGAACACCA
TCATGTGGAGACATTTGCAATTTTCCTCCTAAAATTGCCCATGGGCATTATAAACAATCT
AGTTCATACAGCTTTTTCAAAGAAGAGATTATATATGAATGTGATAAAGGCTACATTCTG
GTCGGACAGGCGAAACTCTCCTGCAGTTATTCACACTGGTCAGCTCCAGCCCCTCAATGT
AAAGCTCTGTGTCGGAAACCAGAATTAGTGAATGGAAGGTTGTCTGTGGATAAGGATCAG
TATGTTGAGCCTGAAAATGTCACCATCCAATGTGATTCTGGCTATGGTGTGGTTGGTCCC
CAAAGTATCACTTGCTCTGGGAACAGAACCTGGTACCCAGAGGTGCCCAAGTGTGAGTGG
GAGACCCCCGAAGGCTGTGAACAAGTGCTCACAGGCAAAAGACTCATGCAGTGTCTCCCA
AACCCAGAGGATGTGAAAATGGCCCTGGAGGTATATAAGCTGTCTCTGGAAATTGAACAA
CTGGAACTACAGAGAGACAGCGCAAGACAATCCACTTTGGATAAAGAACTATAA
Chromosome Location
1
Locus
1q32.2
External Identifiers
ResourceLink
UniProtKB IDP04003
UniProtKB Entry NameC4BPA_HUMAN
HGNC IDHGNC:1325
General References
  1. Matsuguchi T, Okamura S, Aso T, Sata T, Niho Y: Molecular cloning of the cDNA coding for proline-rich protein (PRP): identity of PRP as C4b-binding protein. Biochem Biophys Res Commun. 1989 Nov 30;165(1):138-44. [PubMed:2590215]
  2. Aso T, Okamura S, Matsuguchi T, Sakamoto N, Sata T, Niho Y: Genomic organization of the alpha chain of the human C4b-binding protein gene. Biochem Biophys Res Commun. 1991 Jan 15;174(1):222-7. [PubMed:1989602]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Lintin SJ, Lewin AR, Reid KB: Derivation of the sequence of the signal peptide in human C4b-binding protein and interspecies cross-hybridisation of the C4bp cDNA sequence. FEBS Lett. 1988 May 23;232(2):328-32. [PubMed:3378624]
  6. Lintin SJ, Reid KB: Studies on the structure of the human C4b-binding protein gene. FEBS Lett. 1986 Aug 11;204(1):77-81. [PubMed:3017751]
  7. Chung LP, Bentley DR, Reid KB: Molecular cloning and characterization of the cDNA coding for C4b-binding protein, a regulatory protein of the classical pathway of the human complement system. Biochem J. 1985 Aug 15;230(1):133-41. [PubMed:3840370]
  8. Chung LP, Gagnon J, Reid KB: Amino acid sequence studies of human C4b-binding protein: N-terminal sequence analysis and alignment of the fragments produced by limited proteolysis with chymotrypsin and the peptides produced by cyanogen bromide treatment. Mol Immunol. 1985 Apr;22(4):427-35. [PubMed:4033666]
  9. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [PubMed:14760718]
  10. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  11. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  12. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  13. Dahlback B, Smith CA, Muller-Eberhard HJ: Visualization of human C4b-binding protein and its complexes with vitamin K-dependent protein S and complement protein C4b. Proc Natl Acad Sci U S A. 1983 Jun;80(11):3461-5. [PubMed:6222381]
  14. Jenkins HT, Mark L, Ball G, Persson J, Lindahl G, Uhrin D, Blom AM, Barlow PN: Human C4b-binding protein, structural basis for interaction with streptococcal M protein, a major bacterial virulence factor. J Biol Chem. 2006 Feb 10;281(6):3690-7. Epub 2005 Dec 5. [PubMed:16330538]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails