Vitronectin

Details

Name
Vitronectin
Synonyms
  • S-protein
  • Serum-spreading factor
  • V75
  • VN
Gene Name
VTN
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016301|Vitronectin
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Number of residues
478
Molecular Weight
54305.135
Theoretical pI
5.54
GO Classification
Functions
extracellular matrix binding / heparin binding / integrin binding / polysaccharide binding / scavenger receptor activity
Processes
cell adhesion / cell adhesion mediated by integrin / cell-matrix adhesion / endodermal cell differentiation / extracellular matrix organization / immune response / innate immune response / negative regulation of blood coagulation / negative regulation of endopeptidase activity / oligodendrocyte differentiation / positive regulation of cell-substrate adhesion / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of protein binding / positive regulation of receptor-mediated endocytosis / positive regulation of smooth muscle cell migration / positive regulation of vascular endothelial growth factor receptor signaling pathway / positive regulation of wound healing / regulation of complement activation / smooth muscle cell-matrix adhesion
Components
alphav-beta3 integrin-vitronectin complex / blood microparticle / extracellular exosome / extracellular matrix / extracellular region / extracellular space / proteinaceous extracellular matrix
General Function
Scavenger receptor activity
Specific Function
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0016302|Vitronectin (VTN)
ATGGCACCCCTGAGACCCCTTCTCATACTGGCCCTGCTGGCATGGGTTGCTCTGGCTGAC
CAAGAGTCATGCAAGGGCCGCTGCACTGAGGGCTTCAACGTGGACAAGAAGTGCCAGTGT
GACGAGCTCTGCTCTTACTACCAGAGCTGCTGCACAGACTATACGGCTGAGTGCAAGCCC
CAAGTGACTCGCGGGGATGTGTTCACTATGCCGGAGGATGAGTACACGGTCTATGACGAT
GGCGAGGAGAAAAACAATGCCACTGTCCATGAACAGGTGGGGGGCCCCTCCCTGACCTCT
GACCTCCAGGCCCAGTCCAAAGGGAATCCTGAGCAGACACCTGTTCTGAAACCTGAGGAA
GAGGCCCCTGCGCCTGAGGTGGGCGCCTCTAAGCCTGAGGGGATAGACTCAAGGCCTGAG
ACCCTTCATCCAGGGAGACCTCAGCCCCCAGCAGAGGAGGAGCTGTGCAGTGGGAAGCCC
TTCGACGCCTTCACCGACCTCAAGAACGGTTCCCTCTTTGCCTTCCGAGGGCAGTACTGC
TATGAACTGGACGAAAAGGCAGTGAGGCCTGGGTACCCCAAGCTCATCCGAGATGTCTGG
GGCATCGAGGGCCCCATCGATGCCGCCTTCACCCGCATCAACTGTCAGGGGAAGACCTAC
CTCTTCAAGGGTAGTCAGTACTGGCGCTTTGAGGATGGTGTCCTGGACCCTGATTACCCC
CGAAATATCTCTGACGGCTTCGATGGCATCCCGGACAACGTGGATGCAGCCTTGGCCCTC
CCTGCCCATAGCTACAGTGGCCGGGAGCGGGTCTACTTCTTCAAGGGGAAACAGTACTGG
GAGTACCAGTTCCAGCACCAGCCCAGTCAGGAGGAGTGTGAAGGCAGCTCCCTGTCGGCT
GTGTTTGAACACTTTGCCATGATGCAGCGGGACAGCTGGGAGGACATCTTCGAGCTTCTC
TTCTGGGGCAGAACCTCTGCTGGTACCAGACAGCCCCAGTTCATTAGCCGGGACTGGCAC
GGTGTGCCAGGGCAAGTGGACGCAGCCATGGCTGGCCGCATCTACATCTCAGGCATGGCA
CCCCGCCCCTCCTTGGCCAAGAAACAAAGGTTTAGGCATCGCAACCGCAAAGGCTACCGT
TCACAACGAGGCCACAGCCGTGGCCGCAACCAGAACTCCCGCCGGCCATCCCGCGCCACG
TGGCTGTCCTTGTTCTCCAGTGAGGAGAGCAACTTGGGAGCCAACAACTATGATGACTAC
AGGATGGACTGGCTTGTGCCTGCCACCTGTGAACCCATCCAGAGTGTCTTCTTCTTCTCT
GGAGACAAGTACTACCGAGTCAATCTTCGCACACGGCGAGTGGACACTGTGGACCCTCCC
TACCCACGCTCCATCGCTCAGTACTGGCTGGGCTGCCCAGCTCCTGGCCATCTGTAG
Chromosome Location
17
Locus
17q11
External Identifiers
ResourceLink
UniProtKB IDP04004
UniProtKB Entry NameVTNC_HUMAN
GenBank Protein ID36575
GenBank Gene IDX03168
GenAtlas IDVTN
HGNC IDHGNC:12724
General References
  1. Suzuki S, Oldberg A, Hayman EG, Pierschbacher MD, Ruoslahti E: Complete amino acid sequence of human vitronectin deduced from cDNA. Similarity of cell attachment sites in vitronectin and fibronectin. EMBO J. 1985 Oct;4(10):2519-24. [PubMed:2414098]
  2. Jenne D, Stanley KK: Molecular cloning of S-protein, a link between complement, coagulation and cell-substrate adhesion. EMBO J. 1985 Dec 1;4(12):3153-7. [PubMed:3004934]
  3. Jenne D, Stanley KK: Nucleotide sequence and organization of the human S-protein gene: repeating peptide motifs in the "pexin" family and a model for their evolution. Biochemistry. 1987 Oct 20;26(21):6735-42. [PubMed:2447940]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Fryklund L, Sievertsson H: Primary structure of somatomedin B: a growth hormone-dependent serum factor with protease inhibiting activity. FEBS Lett. 1978 Mar 1;87(1):55-60. [PubMed:631332]
  7. Sigurdardottir O, Wiman B: Identification of a PAI-1 binding site in vitronectin. Biochim Biophys Acta. 1994 Sep 21;1208(1):104-10. [PubMed:7522053]
  8. Yaoi Y, Hashimoto K, Takahara K, Kato I: Insulin binds to type V collagen with retention of mitogenic activity. Exp Cell Res. 1991 Jun;194(2):180-5. [PubMed:1709100]
  9. McGuire EA, Peacock ME, Inhorn RC, Siegel NR, Tollefsen DM: Phosphorylation of vitronectin by a protein kinase in human plasma. Identification of a unique phosphorylation site in the heparin-binding domain. J Biol Chem. 1988 Feb 5;263(4):1942-5. [PubMed:2448300]
  10. Jenne D, Hille A, Stanley KK, Huttner WB: Sulfation of two tyrosine-residues in human complement S-protein (vitronectin). Eur J Biochem. 1989 Nov 6;185(2):391-5. [PubMed:2479556]
  11. Chain D, Korc-Grodzicki B, Kreizman T, Shaltiel S: The phosphorylation of the two-chain form of vitronectin by protein kinase A is heparin dependent. FEBS Lett. 1990 Aug 20;269(1):221-5. [PubMed:1696913]
  12. Seiffert D, Loskutoff DJ: Evidence that type 1 plasminogen activator inhibitor binds to the somatomedin B domain of vitronectin. J Biol Chem. 1991 Feb 15;266(5):2824-30. [PubMed:1704366]
  13. Lim BL, Reid KB, Ghebrehiwet B, Peerschke EI, Leigh LA, Preissner KT: The binding protein for globular heads of complement C1q, gC1qR. Functional expression and characterization as a novel vitronectin binding factor. J Biol Chem. 1996 Oct 25;271(43):26739-44. [PubMed:8900153]
  14. Seger D, Gechtman Z, Shaltiel S: Phosphorylation of vitronectin by casein kinase II. Identification of the sites and their promotion of cell adhesion and spreading. J Biol Chem. 1998 Sep 18;273(38):24805-13. [PubMed:9733784]
  15. Kamikubo Y, Okumura Y, Loskutoff DJ: Identification of the disulfide bonds in the recombinant somatomedin B domain of human vitronectin. J Biol Chem. 2002 Jul 26;277(30):27109-19. Epub 2002 May 17. [PubMed:12019263]
  16. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [PubMed:14760718]
  17. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  18. Beranova-Giorgianni S, Zhao Y, Desiderio DM, Giorgianni F: Phosphoproteomic analysis of the human pituitary. Pituitary. 2006;9(2):109-20. [PubMed:16807684]
  19. Yu Y, Hoffhines AJ, Moore KL, Leary JA: Determination of the sites of tyrosine O-sulfation in peptides and proteins. Nat Methods. 2007 Jul;4(7):583-8. Epub 2007 Jun 10. [PubMed:17558413]
  20. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087]
  21. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  22. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [PubMed:19139490]
  23. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  24. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  25. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  26. Zhou A, Huntington JA, Pannu NS, Carrell RW, Read RJ: How vitronectin binds PAI-1 to modulate fibrinolysis and cell migration. Nat Struct Biol. 2003 Jul;10(7):541-4. [PubMed:12808446]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00054AbciximabapprovedunknownDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails