DNA adenine methylase

Details

Name
DNA adenine methylase
Synonyms
  • 2.1.1.72
  • Deoxyadenosyl-methyltransferase
  • DNA-(N(6)-adenine)-methyltransferase
  • M.EcoT4Dam
Gene Name
DAM
Organism
Enterobacteria phage T4
Amino acid sequence
>lcl|BSEQ0011798|DNA adenine methylase
MLGAIAYTGNKQSLLPELKSHFPKYNRFVDLFCGGLSVSLNVNGPVLANDIQEPIIEMYK
RLINVSWDDVLKVIKQYKLSKTSKEEFLKLREDYNKTRDPLLLYVLHFHGFSNMIRINDK
GNFTTPFGKRTINKNSEKQYNHFKQNCDKIIFSSLHFKDVKILDGDFVYVDPPYLITVAD
YNKFWSEDEEKDLLNLLDSLNDRGIKFGQSNVLEHHGKENTLLKEWSKKYNVKHLNKKYV
FNIYHSKEKNGTDEVYIFN
Number of residues
259
Molecular Weight
30416.59
Theoretical pI
9.24
GO Classification
Functions
nucleic acid binding / site-specific DNA-methyltransferase (adenine-specific) activity
Processes
DNA replication / viral process
General Function
Site-specific dna-methyltransferase (adenine-specific) activity
Specific Function
Methyltransferase that methylates adenine residues in the dsDNA sequence GATC. May prevents degradation of viral DNA by the host restriction-modification antiviral defense system.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0011799|DNA adenine methylase (DAM)
ATGCTAGGAGCTATCGCGTATACAGGTAATAAACAATCATTATTACCTGAACTCAAATCT
CACTTTCCAAAATATAACAGATTCGTGGATTTATTTTGTGGAGGTTTATCAGTGTCTTTG
AATGTTAATGGCCCTGTATTGGCCAATGATATTCAAGAACCAATTATTGAAATGTATAAG
CGTCTTATTAATGTATCATGGGATGACGTTTTAAAAGTAATAAAGCAATACAAACTATCA
AAAACATCAAAAGAAGAGTTTTTGAAATTACGTGAAGATTATAATAAAACTAGAGATCCT
CTTTTACTTTATGTTCTTCATTTTCACGGATTTAGTAATATGATTCGTATAAACGATAAA
GGAAATTTTACTACTCCGTTTGGAAAAAGAACTATAAACAAAAATAGTGAAAAACAATAT
AATCACTTTAAACAAAATTGTGATAAAATAATCTTTAGTTCATTGCATTTTAAAGATGTT
AAAATTTTAGACGGCGATTTTGTATATGTAGATCCTCCGTATCTCATAACAGTTGCTGAT
TATAATAAATTTTGGTCAGAAGATGAAGAAAAAGACCTTTTAAATCTTTTAGATTCTTTA
AATGATAGAGGAATAAAATTTGGGCAGTCGAATGTTTTAGAACACCACGGAAAGGAAAAC
ACTCTTCTTAAAGAATGGTCTAAAAAATATAATGTAAAGCATCTTAATAAAAAATACGTC
TTTAACATATATCATTCCAAAGAAAAGAATGGAACTGATGAAGTATATATTTTTAATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP04392
UniProtKB Entry NameDMA_BPT4
GenBank Gene IDX01416
General References
  1. Macdonald PM, Mosig G: Regulation of a new bacteriophage T4 gene, 69, that spans an origin of DNA replication. EMBO J. 1984 Dec 1;3(12):2863-71. [PubMed:6098451]
  2. Miner Z, Schlagman SL, Hattman S: Single amino acid changes that alter the DNA sequence specificity of the DNA-[N6-adenine] methyltransferase (Dam) of bacteriophage T4. Nucleic Acids Res. 1989 Oct 25;17(20):8149-57. [PubMed:2510127]
  3. Miller ES, Kutter E, Mosig G, Arisaka F, Kunisawa T, Ruger W: Bacteriophage T4 genome. Microbiol Mol Biol Rev. 2003 Mar;67(1):86-156, table of contents. [PubMed:12626685]
  4. Kossykh VG, Schlagman SL, Hattman S: Phage T4 DNA [N6-adenine]methyltransferase. Overexpression, purification, and characterization. J Biol Chem. 1995 Jun 16;270(24):14389-93. [PubMed:7782299]
  5. Zinoviev VV, Evdokimov AA, Malygin EG, Schlagman SL, Hattman S: Bacteriophage T4 Dam DNA-(N6-adenine)-methyltransferase. Processivity and orientation to the methylation target. J Biol Chem. 2003 Mar 7;278(10):7829-33. Epub 2002 Dec 24. [PubMed:12501249]
  6. Yang Z, Horton JR, Zhou L, Zhang XJ, Dong A, Zhang X, Schlagman SL, Kossykh V, Hattman S, Cheng X: Structure of the bacteriophage T4 DNA adenine methyltransferase. Nat Struct Biol. 2003 Oct;10(10):849-55. Epub 2003 Aug 24. [PubMed:12937411]
  7. Horton JR, Liebert K, Hattman S, Jeltsch A, Cheng X: Transition from nonspecific to specific DNA interactions along the substrate-recognition pathway of dam methyltransferase. Cell. 2005 May 6;121(3):349-61. [PubMed:15882618]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails