HLA class I histocompatibility antigen, A-3 alpha chain

Details

Name
HLA class I histocompatibility antigen, A-3 alpha chain
Synonyms
  • HLAA
  • MHC class I antigen A*3
Gene Name
HLA-A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012429|HLA class I histocompatibility antigen, A-3 alpha chain
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQ
IMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQL
RAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL
TACKV
Number of residues
365
Molecular Weight
40840.41
Theoretical pI
5.85
GO Classification
Functions
beta-2-microglobulin binding / peptide antigen binding / TAP binding
Processes
antigen processing and presentation of exogenous peptide antigen via MHC class I / antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent / antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent / antigen processing and presentation of peptide antigen via MHC class I / cytokine-mediated signaling pathway / immune response / interferon-gamma-mediated signaling pathway / regulation of immune response / type I interferon signaling pathway / viral process
Components
cell surface / early endosome membrane / endoplasmic reticulum / ER to Golgi transport vesicle membrane / Golgi apparatus / Golgi membrane / integral component of lumenal side of endoplasmic reticulum membrane / integral component of plasma membrane / membrane / MHC class I protein complex / phagocytic vesicle membrane / plasma membrane
General Function
Tap binding
Specific Function
Involved in the presentation of foreign antigens to the immune system.
Pfam Domain Function
Transmembrane Regions
309-332
Cellular Location
Membrane
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP04439
UniProtKB Entry Name1A03_HUMAN
GenBank Gene IDAF226843
GenAtlas IDHLA-A
HGNC IDHGNC:4931
General References
  1. Strachan T, Sodoyer R, Damotte M, Jordan BR: Complete nucleotide sequence of a functional class I HLA gene, HLA-A3: implications for the evolution of HLA genes. EMBO J. 1984 Apr;3(4):887-94. [Article]
  2. Cowan EP, Jordan BR, Coligan JE: Molecular cloning and DNA sequence analysis of genes encoding cytotoxic T lymphocyte-defined HLA-A3 subtypes: the E1 subtype. J Immunol. 1985 Oct;135(4):2835-41. [Article]
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [Article]
  4. Santos S, Balas A, Garcia-Sanchez F, Lillo R, Merino JL, Vicario JL: Complete cDNA coding sequence of a new HLA-A3 subtype (A*0304) with a new HLA polymorphism at exon 3. Immunogenetics. 1999 Apr;49(4):360-1. [Article]
  5. Bradshaw D, Gans CP, Jones P, Rizzuto G, Steiner N, Mitton W, Ng J, Koester R, Hartzman RJ, Hurley CK: Novel HLA-A locus alleles including A*01012, A*0306, A*0308, A*2616, A*2617, A*3009, A*3206, A*3403, A*3602 and A*6604. Tissue Antigens. 2002 Apr;59(4):325-7. [Article]
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  7. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
  8. McMahon RM, Friis L, Siebold C, Friese MA, Fugger L, Jones EY: Structure of HLA-A*0301 in complex with a peptide of proteolipid protein: insights into the role of HLA-A alleles in susceptibility to multiple sclerosis. Acta Crystallogr D Biol Crystallogr. 2011 May;67(Pt 5):447-54. doi: 10.1107/S0907444911007888. Epub 2011 Apr 13. [Article]
  9. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06226Nelipepimut-SinvestigationalunknownDetails
DB027403-Indolebutyric AcidexperimentalunknownDetails
DB11294Coccidioides immitis spheruleapprovedunknownbinderDetails
DB06226Nelipepimut-SinvestigationalunknownDetails
DB11294Coccidioides immitis spheruleapprovedunknownDetails