Glycogen phosphorylase, liver form

Details

Name
Glycogen phosphorylase, liver form
Synonyms
  • 2.4.1.1
Gene Name
PYGL
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037666|Glycogen phosphorylase, liver form
MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDI
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQ
ENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFV
PRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN
Number of residues
847
Molecular Weight
97147.82
Theoretical pI
7.17
GO Classification
Functions
AMP binding / ATP binding / bile acid binding / drug binding / glucose binding / glycogen phosphorylase activity / protein homodimerization activity / purine nucleobase binding / pyridoxal phosphate binding / vitamin binding
Processes
5-phosphoribose 1-diphosphate biosynthetic process / carbohydrate metabolic process / glucose homeostasis / glucose metabolic process / glycogen catabolic process / glycogen metabolic process / necroptotic process / small molecule metabolic process
Components
cytoplasm / cytosol / extracellular exosome / plasma membrane
General Function
Vitamin binding
Specific Function
Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0009869|Glycogen phosphorylase, liver form (PYGL)
ATGGCGAAGCCCCTGACGGACCAGGAGAAGCGGCGGCAGATCAGCATCCGCGGCATCGTG
GGCGTGGAGAACGTGGCAGAGCTGAAGAAGAGTTTCAACCGGCACCTGCACTTCACGCTG
GTCAAGGACCGCAACGTGGCCACCACCCGCGACTACTACTTCGCGCTGGCGCACACGGTG
CGCGACCACCTGGTGGGGCGCTGGATCCGCACGCAGCAGCACTACTACGACAAGTGCCCC
AAGCTTGGATTGGATATAGAAGAGTTAGAAGAAATTGAAGAAGATGCTGGACTTGGCAAT
GGTGGTCTTGGGAGACTTGCTGCCTGCTTCTTGGATTCCATGGCAACCCTGGGACTTGCA
GCCTATGGATACGGCATTCGGTATGAATATGGGATTTTCAATCAGAAGATCCGAGATGGA
TGGCAGGTAGAAGAAGCAGATGATTGGCTCAGATATGGAAACCCTTGGGAGAAGTCCCGC
CCAGAATTCATGCTGCCTGTGCACTTCTATGGAAAAGTAGAACACACCAACACCGGGACC
AAGTGGATTGACACTCAAGTGGTCCTGGCTCTGCCATATGACACCCCCGTGCCCGGCTAC
ATGAATAACACTGTCAACACCATGCGCCTCTGGTCTGCTCGGGCACCAAATGACTTTAAC
CTCAGAGACTTTAATGTTGGAGACTACATTCAGGCTGTGCTGGACCGAAACCTGGCCGAG
AACATCTCCCGGGTCCTCTATCCCAATGACAATTTTTTTGAAGGGAAGGAGCTAAGATTG
AAGCAGGAATACTTTGTGGTGGCTGCAACCTTGCAAGATATCATCCGCCGTTTCAAAGCC
TCCAAGTTTGGCTCCACCCGTGGTGCAGGAACTGTGTTTGATGCCTTCCCGGATCAGGTG
GCCATCCAGCTGAATGACACTCACCCTGCACTCGCGATCCCTGAGCTGATGAGGATTTTT
GTGGATATTGAAAAACTGCCCTGGTCCAAGGCATGGGAGCTCACCCAGAAGACCTTCGCC
TACACCAACCACACAGTGCTCCCGGAAGCCCTGGAGCGCTGGCCCGTGGACCTGGTGGAG
AAGCTGCTCCCTCGACATTTGGAAATCATTTATGAGATAAATCAGAAGCATTTAGATAGA
ATTGTGGCCTTGTTTCCTAAAGATGTGGACCGTCTGAGAAGGATGTCTCTGATAGAAGAG
GAAGGAAGCAAAAGGATCAACATGGCCCATCTCTGCATTGTCGGTTCCCATGCTGTGAAT
GGCGTGGCTAAAATCCACTCAGACATCGTGAAGACTAAAGTATTCAAGGACTTCAGTGAG
CTAGAACCTGACAAGTTTCAGAATAAAACCAATGGGATCACTCCAAGGCGCTGGCTCCTA
CTCTGCAACCCAGGACTTGCAGAGCTCATAGCAGAGAAAATTGGAGAAGACTATGTGAAA
GACCTGAGCCAGCTGACGAAGCTCCACAGCTTCCTGGGTGATGATGTCTTCCTCCGGGAA
CTCGCCAAGGTGAAGCAGGAGAATAAGCTGAAGTTTTCTCAGTTCCTGGAGACGGAGTAC
AAAGTGAAGATCAACCCATCCTCCATGTTTGATGTCCAGGTGAAGAGGATACATGAGTAC
AAGCGACAGCTCTTGAACTGTCTGCATGTGATCACGATGTACAACCGCATTAAGAAAGAC
CCTAAGAAGTTATTCGTGCCAAGGACAGTTATCATTGGTGGTAAAGCTGCCCCAGGATAT
CACATGGCCAAAATGATCATAAAGCTGATCACTTCAGTGGCAGATGTGGTGAACAATGAC
CCTATGGTTGGAAGCAAGTTGAAAGTCATCTTCTTGGAGAACTACAGAGTATCTCTTGCT
GAAAAAGTCATTCCAGCCACAGATCTGTCAGAGCAGATTTCCACTGCAGGCACCGAAGCC
TCGGGGACAGGCAATATGAAGTTCATGCTAAATGGGGCCCTAACTATCGGGACCATGGAT
GGGGCCAATGTGGAAATGGCAGAAGAAGCTGGGGAAGAGAACCTGTTCATCTTTGGCATG
AGGATAGATGATGTGGCTGCTTTGGACAAGAAAGGGTACGAGGCAAAAGAATACTATGAG
GCACTTCCAGAGCTGAAGCTGGTCATTGATCAAATTGACAATGGCTTTTTTTCTCCCAAG
CAGCCTGACCTCTTCAAAGATATCATCAACATGCTATTTTATCATGACAGGTTTAAAGTC
TTTGCAGACTACGAAGCCTATGTCAAGTGTCAAGATAAAGTGAGTCAGCTGTACATGAAT
CCAAAGGCCTGGAACACAATGGTACTCAAAAACATAGCTGCCTCGGGGAAATTCTCCAGT
GACCGAACAATTAAAGAATATGCCCAAAACATCTGGAACGTGGAACCTTCAGATCTAAAG
ATTTCTCTATCCAATGAATCTAACAAAGTCAATGGAAATTGA
Chromosome Location
14
Locus
14q21-q22
External Identifiers
ResourceLink
UniProtKB IDP06737
UniProtKB Entry NamePYGL_HUMAN
GenBank Protein ID183353
GenBank Gene IDM14636
GenAtlas IDPYGL
HGNC IDHGNC:9725
General References
  1. Newgard CB, Nakano K, Hwang PK, Fletterick RJ: Sequence analysis of the cDNA encoding human liver glycogen phosphorylase reveals tissue-specific codon usage. Proc Natl Acad Sci U S A. 1986 Nov;83(21):8132-6. [PubMed:2877458]
  2. Chang S, Rosenberg MJ, Morton H, Francomano CA, Biesecker LG: Identification of a mutation in liver glycogen phosphorylase in glycogen storage disease type VI. Hum Mol Genet. 1998 May;7(5):865-70. [PubMed:9536091]
  3. Burwinkel B, Bakker HD, Herschkovitz E, Moses SW, Shin YS, Kilimann MW: Mutations in the liver glycogen phosphorylase gene (PYGL) underlying glycogenosis type VI. Am J Hum Genet. 1998 Apr;62(4):785-91. [PubMed:9529348]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Gorin FA, Mullinax RL, Ignacio PC, Neve RL, Kurnit DM: McArdle's & Hers' diseases: glycogen phosphorylase transcriptional expression in human tissues. J Neurogenet. 1987 Dec;4(6):293-308. [PubMed:3509980]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  9. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  10. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [PubMed:22814378]
  11. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  12. Rath VL, Ammirati M, Danley DE, Ekstrom JL, Gibbs EM, Hynes TR, Mathiowetz AM, McPherson RK, Olson TV, Treadway JL, Hoover DJ: Human liver glycogen phosphorylase inhibitors bind at a new allosteric site. Chem Biol. 2000 Sep;7(9):677-82. [PubMed:10980448]
  13. Rath VL, Ammirati M, LeMotte PK, Fennell KF, Mansour MN, Danley DE, Hynes TR, Schulte GK, Wasilko DJ, Pandit J: Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core. Mol Cell. 2000 Jul;6(1):139-48. [PubMed:10949035]
  14. Ekstrom JL, Pauly TA, Carty MD, Soeller WC, Culp J, Danley DE, Hoover DJ, Treadway JL, Gibbs EM, Fletterick RJ, Day YS, Myszka DG, Rath VL: Structure-activity analysis of the purine binding site of human liver glycogen phosphorylase. Chem Biol. 2002 Aug;9(8):915-24. [PubMed:12204691]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00114Pyridoxal phosphateapproved, investigational, nutraceuticalunknowncofactorDetails
DB00131Adenosine phosphateapproved, investigational, nutraceuticalunknownactivatorDetails
DB02089CP-526423experimentalunknownDetails
DB02320N-beta-D-glucopyranosylacetamideexperimentalunknownDetails
DB032885-Chloro-1h-Indole-2-Carboxylic Acid{[Cyclopentyl-(2-Hydroxy-Ethyl)-Carbamoyl]-Methyl}-AmideexperimentalunknownDetails
DB03744Cp403700, (S)-1-{2-[(5-Chloro-1h-Indole-2-Carbonyl)-Amino]-3-Phenyl-Propionyl}-Azetidine-3-CarboxylateexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB04522DexfosfoserineexperimentalunknownDetails
DB05044PSN357investigationalunknownDetails
DB073155-chloro-N-{4-[(1R)-1,2-dihydroxyethyl]phenyl}-1H-indole-2-carboxamideexperimentalunknownDetails
DB073954-[3-(2-Chloro-4,5-difluoro-benzoyl)ureido]-3-trifluoromethoxybenzoic acidexperimentalunknownDetails
DB07396AVE-2865experimentalunknownDetails
DB07968N-(2-CHLORO-4-FLUOROBENZOYL)-N'-(5-HYDROXY-2-METHOXYPHENYL)UREAexperimentalunknownDetails
DB08844Uric acidinvestigationalunknownDetails
DB03496Alvocidibexperimental, investigationalunknownDetails