Integrin alpha-V

Details

Name
Integrin alpha-V
Synonyms
  • MSK8
  • Vitronectin receptor subunit alpha
  • VNRA
Gene Name
ITGAV
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006887|Integrin alpha-V
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
Number of residues
1048
Molecular Weight
116036.855
Theoretical pI
5.36
GO Classification
Functions
extracellular matrix binding / extracellular matrix protein binding / fibronectin binding / metal ion binding / protease binding / transforming growth factor beta binding / virus receptor activity / voltage-gated calcium channel activity
Processes
angiogenesis / antigen processing and presentation of exogenous peptide antigen via MHC class I / antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent / antigen processing and presentation of peptide antigen via MHC class I / apolipoprotein A-I-mediated signaling pathway / apoptotic cell clearance / axon guidance / blood coagulation / calcium ion transmembrane transport / cell adhesion / cell growth / cell migration / cell-matrix adhesion / cell-substrate adhesion / endodermal cell differentiation / entry of symbiont into host cell by promotion of host phagocytosis / ERK1 and ERK2 cascade / extracellular matrix organization / extrinsic apoptotic signaling pathway in absence of ligand / heterotypic cell-cell adhesion / integrin-mediated signaling pathway / leukocyte migration / negative chemotaxis / negative regulation of entry of bacterium into host cell / negative regulation of extrinsic apoptotic signaling pathway / negative regulation of lipid storage / negative regulation of lipid transport / negative regulation of lipoprotein metabolic process / negative regulation of low-density lipoprotein particle receptor biosynthetic process / negative regulation of macrophage derived foam cell differentiation / positive regulation of cell adhesion / positive regulation of cell migration / positive regulation of cell proliferation / positive regulation of osteoblast proliferation / regulation of apoptotic cell clearance / regulation of phagocytosis / substrate adhesion-dependent cell spreading / vascular endothelial growth factor receptor signaling pathway / viral entry into host cell
Components
alphav-beta3 integrin-IGF-1-IGF1R complex / cell surface / external side of plasma membrane / extracellular exosome / filopodium membrane / focal adhesion / integral component of plasma membrane / integrin alphav-beta3 complex / integrin alphav-beta5 complex / integrin alphav-beta8 complex / integrin complex / lamellipodium membrane / membrane / microvillus membrane / phagocytic vesicle / plasma membrane / ruffle membrane
General Function
Voltage-gated calcium channel activity
Specific Function
The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands.(Microbial infection) Integrin ITGAV:ITGB5 acts as a receptor for adenovirus type C (PubMed:20615244). Integrin ITGAV:ITGB5 and ITGAV:ITGB3 act as receptors for coxsackievirus A9 and B1 (PubMed:9426447, PubMed:15194773, PubMed:7519807). Integrin ITGAV:ITGB3 acts as a receptor for herpes virus 8/HHV-8 (PubMed:18045938). Integrin ITGAV:ITGB6 acts as a receptor for herpes simplex 1/HHV-1 (PubMed:24367260). Integrin ITGAV:ITGB3 acts as a receptor for Human parechovirus 1 (PubMed:11160695). Integrin ITGAV:ITGB3 acts as a receptor for West nile virus (PubMed:23658209). In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions (PubMed:10397733).
Pfam Domain Function
Transmembrane Regions
993-1016
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0012486|Integrin alpha-V (ITGAV)
ATGCTCCTAGGCACCCTCCTTCTGATCCTGTACATCTTAATGTTGTGCCGGATGTTTCTT
CTCGTGGGAGCTCCCAAAGCAAACACCACCCAGCCTGGGATTGTGGAAGGAGGGCAGGTC
CTCAAATGTGACTGGTCTTCTACCCGCCGGTGCCAGCCAATTGAATTTGATGCAACAGGC
AATAGAGATTATGCCAAGGATGATCCATTGGAATTTAAGTCCCATCAGTGGTTTGGAGCA
TCTGTGAGGTCGAAACAGGATAAAATTTTGGCCTGTGCCCCATTGTACCATTGGAGAACT
GAGATGAAACAGGAGCGAGAGCCTGTTGGAACATGCTTTCTTCAAGATGGAACAAAGACT
GTTGAGTATGCTCCATGTAGATCACAAGATATTGATGCTGATGGACAGGGATTTTGTCAA
GGAGGATTCAGCATTGATTTTACTAAAGCTGACAGAGTACTTCTTGGTGGTCCTGGTAGC
TTTTATTGGCAAGGTCAGCTTATTTCGGATCAAGTGGCAGAAATCGTATCTAAATACGAC
CCCAATGTTTACAGCATCAAGTATAATAACCAATTAGCAACTCGGACTGCACAAGCTATT
TTTGATGACAGCTATTTGGGTTATTCTGTGGCTGTCGGAGATTTCAATGGTGATGGCATA
GATGACTTTGTTTCAGGAGTTCCAAGAGCAGCAAGGACTTTGGGAATGGTTTATATTTAT
GATGGGAAGAACATGTCCTCCTTATACAATTTTACTGGCGAGCAGATGGCTGCATATTTC
GGATTTTCTGTAGCTGCCACTGACATTAATGGAGATGATTATGCAGATGTGTTTATTGGA
GCACCTCTCTTCATGGATCGTGGCTCTGATGGCAAACTCCAAGAGGTGGGGCAGGTCTCA
GTGTCTCTACAGAGAGCTTCAGGAGACTTCCAGACGACAAAGCTGAATGGATTTGAGGTC
TTTGCACGGTTTGGCAGTGCCATAGCTCCTTTGGGAGATCTGGACCAGGATGGTTTCAAT
GATATTGCAATTGCTGCTCCATATGGGGGTGAAGATAAAAAAGGAATTGTTTATATCTTC
AATGGAAGATCAACAGGCTTGAACGCAGTCCCATCTCAAATCCTTGAAGGGCAGTGGGCT
GCTCGAAGCATGCCACCAAGCTTTGGCTATTCAATGAAAGGAGCCACAGATATAGACAAA
AATGGATATCCAGACTTAATTGTAGGAGCTTTTGGTGTAGATCGAGCTATCTTATACAGG
GCCAGACCAGTTATCACTGTAAATGCTGGTCTTGAAGTGTACCCTAGCATTTTAAATCAA
GACAATAAAACCTGCTCACTGCCTGGAACAGCTCTCAAAGTTTCCTGTTTTAATGTTAGG
TTCTGCTTAAAGGCAGATGGCAAAGGAGTACTTCCCAGGAAACTTAATTTCCAGGTGGAA
CTTCTTTTGGATAAACTCAAGCAAAAGGGAGCAATTCGACGAGCACTGTTTCTCTACAGC
AGGTCCCCAAGTCACTCCAAGAACATGACTATTTCAAGGGGGGGACTGATGCAGTGTGAG
GAATTGATAGCGTATCTGCGGGATGAATCTGAATTTAGAGACAAACTCACTCCAATTACT
ATTTTTATGGAATATCGGTTGGATTATAGAACAGCTGCTGATACAACAGGCTTGCAACCC
ATTCTTAACCAGTTCACGCCTGCTAACATTAGTCGACAGGCTCACATTCTACTTGACTGT
GGTGAAGACAATGTCTGTAAACCCAAGCTGGAAGTTTCTGTAGATAGTGATCAAAAGAAG
ATCTATATTGGGGATGACAACCCTCTGACATTGATTGTTAAGGCTCAGAATCAAGGAGAA
GGTGCCTACGAAGCTGAGCTCATCGTTTCCATTCCACTGCAGGCTGATTTCATCGGGGTT
GTCCGAAACAATGAAGCCTTAGCAAGACTTTCCTGTGCATTTAAGACAGAAAACCAAACT
CGCCAGGTGGTATGTGACCTTGGAAACCCAATGAAGGCTGGAACTCAACTCTTAGCTGGT
CTTCGTTTCAGTGTGCACCAGCAGTCAGAGATGGATACTTCTGTGAAATTTGACTTACAA
ATCCAAAGCTCAAATCTATTTGACAAAGTAAGCCCAGTTGTATCTCACAAAGTTGATCTT
GCTGTTTTAGCTGCAGTTGAGATAAGAGGAGTCTCGAGTCCTGATCATATCTTTCTTCCG
ATTCCAAACTGGGAGCACAAGGAGAACCCTGAGACTGAAGAAGATGTTGGGCCAGTTGTT
CAGCACATCTATGAGCTGAGAAACAATGGTCCAAGTTCATTCAGCAAGGCAATGCTCCAT
CTTCAGTGGCCTTACAAATATAATAATAACACTCTGTTGTATATCCTTCATTATGATATT
GATGGACCAATGAACTGCACTTCAGATATGGAGATCAACCCTTTGAGAATTAAGATCTCA
TCTTTGCAAACAACTGAAAAGAATGACACGGTTGCCGGGCAAGGTGAGCGGGACCATCTC
ATCACTAAGCGGGATCTTGCCCTCAGTGAAGGAGATATTCACACTTTGGGTTGTGGAGTT
GCTCAGTGCTTGAAGATTGTCTGCCAAGTTGGGAGATTAGACAGAGGAAAGAGTGCAATC
TTGTACGTAAAGTCATTACTGTGGACTGAGACTTTTATGAATAAAGAAAATCAGAATCAT
TCCTATTCTCTGAAGTCGTCTGCTTCATTTAATGTCATAGAGTTTCCTTATAAGAATCTT
CCAATTGAGGATATCACCAACTCCACATTGGTTACCACTAATGTCACCTGGGGCATTCAG
CCAGCGCCCATGCCTGTGCCTGTGTGGGTGATCATTTTAGCAGTTCTAGCAGGATTGTTG
CTACTGGCTGTTTTGGTATTTGTAATGTACAGGATGGGCTTTTTTAAACGGGTCCGGCCA
CCTCAAGAAGAACAAGAAAGGGAGCAGCTTCAACCTCATGAAAATGGTGAAGGAAACTCA
GAAACTTAA
Chromosome Location
2
Locus
2q31-q32
External Identifiers
ResourceLink
UniProtKB IDP06756
UniProtKB Entry NameITAV_HUMAN
GenBank Protein ID340307
GenBank Gene IDM14648
HGNC IDHGNC:6150
General References
  1. Suzuki S, Argraves WS, Arai H, Languino LR, Pierschbacher MD, Ruoslahti E: Amino acid sequence of the vitronectin receptor alpha subunit and comparative expression of adhesion receptor mRNAs. J Biol Chem. 1987 Oct 15;262(29):14080-5. [PubMed:2443500]
  2. Sims MA, Field SD, Barnes MR, Shaikh N, Ellington K, Murphy KE, Spurr N, Campbell DA: Cloning and characterisation of ITGAV, the genomic sequence for human cell adhesion protein (vitronectin) receptor alpha subunit, CD51. Cytogenet Cell Genet. 2000;89(3-4):268-71. [PubMed:10965141]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Donahue JP, Sugg N, Hawiger J: The integrin alpha v gene: identification and characterization of the promoter region. Biochim Biophys Acta. 1994 Sep 13;1219(1):228-32. [PubMed:7522056]
  7. Suzuki S, Argraves WS, Pytela R, Arai H, Krusius T, Pierschbacher MD, Ruoslahti E: cDNA and amino acid sequences of the cell adhesion protein receptor recognizing vitronectin reveal a transmembrane domain and homologies with other adhesion protein receptors. Proc Natl Acad Sci U S A. 1986 Nov;83(22):8614-8. [PubMed:2430295]
  8. Cheresh DA, Smith JW, Cooper HM, Quaranta V: A novel vitronectin receptor integrin (alpha v beta x) is responsible for distinct adhesive properties of carcinoma cells. Cell. 1989 Apr 7;57(1):59-69. [PubMed:2467745]
  9. Roivainen M, Piirainen L, Hovi T, Virtanen I, Riikonen T, Heino J, Hyypia T: Entry of coxsackievirus A9 into host cells: specific interactions with alpha v beta 3 integrin, the vitronectin receptor. Virology. 1994 Sep;203(2):357-65. [PubMed:7519807]
  10. Agrez MV, Shafren DR, Gu X, Cox K, Sheppard D, Barry RD: Integrin alpha v beta 6 enhances coxsackievirus B1 lytic infection of human colon cancer cells. Virology. 1997 Dec 8;239(1):71-7. [PubMed:9426447]
  11. Barillari G, Sgadari C, Fiorelli V, Samaniego F, Colombini S, Manzari V, Modesti A, Nair BC, Cafaro A, Sturzl M, Ensoli B: The Tat protein of human immunodeficiency virus type-1 promotes vascular cell growth and locomotion by engaging the alpha5beta1 and alphavbeta3 integrins and by mobilizing sequestered basic fibroblast growth factor. Blood. 1999 Jul 15;94(2):663-72. [PubMed:10397733]
  12. Joki-Korpela P, Marjomaki V, Krogerus C, Heino J, Hyypia T: Entry of human parechovirus 1. J Virol. 2001 Feb;75(4):1958-67. [PubMed:11160695]
  13. Lin CG, Leu SJ, Chen N, Tebeau CM, Lin SX, Yeung CY, Lau LF: CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family. J Biol Chem. 2003 Jun 27;278(26):24200-8. Epub 2003 Apr 13. [PubMed:12695522]
  14. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519]
  15. Krokhin OV, Cheng K, Sousa SL, Ens W, Standing KG, Wilkins JA: Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains. Biochemistry. 2003 Nov 11;42(44):12950-9. [PubMed:14596610]
  16. Williams CH, Kajander T, Hyypia T, Jackson T, Sheppard D, Stanway G: Integrin alpha v beta 6 is an RGD-dependent receptor for coxsackievirus A9. J Virol. 2004 Jul;78(13):6967-73. [PubMed:15194773]
  17. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  18. Caswell PT, Spence HJ, Parsons M, White DP, Clark K, Cheng KW, Mills GB, Humphries MJ, Messent AJ, Anderson KI, McCaffrey MW, Ozanne BW, Norman JC: Rab25 associates with alpha5beta1 integrin to promote invasive migration in 3D microenvironments. Dev Cell. 2007 Oct;13(4):496-510. [PubMed:17925226]
  19. Garrigues HJ, Rubinchikova YE, Dipersio CM, Rose TM: Integrin alphaVbeta3 Binds to the RGD motif of glycoprotein B of Kaposi's sarcoma-associated herpesvirus and functions as an RGD-dependent entry receptor. J Virol. 2008 Feb;82(3):1570-80. Epub 2007 Nov 28. [PubMed:18045938]
  20. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  21. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  22. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973]
  23. Lyle C, McCormick F: Integrin alphavbeta5 is a primary receptor for adenovirus in CAR-negative cells. Virol J. 2010 Jul 8;7:148. doi: 10.1186/1743-422X-7-148. [PubMed:20615244]
  24. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  25. Freeman TC Jr, Black JL, Bray HG, Dagliyan O, Wu YI, Tripathy A, Dokholyan NV, Leisner TM, Parise LV: Identification of novel integrin binding partners for calcium and integrin binding protein 1 (CIB1): structural and thermodynamic basis of CIB1 promiscuity. Biochemistry. 2013 Oct 8;52(40):7082-90. doi: 10.1021/bi400678y. Epub 2013 Sep 25. [PubMed:24011356]
  26. Gianni T, Salvioli S, Chesnokova LS, Hutt-Fletcher LM, Campadelli-Fiume G: alphavbeta6- and alphavbeta8-integrins serve as interchangeable receptors for HSV gH/gL to promote endocytosis and activation of membrane fusion. PLoS Pathog. 2013;9(12):e1003806. doi: 10.1371/journal.ppat.1003806. Epub 2013 Dec 19. [PubMed:24367260]
  27. Schmidt K, Keller M, Bader BL, Korytar T, Finke S, Ziegler U, Groschup MH: Integrins modulate the infection efficiency of West Nile virus into cells. J Gen Virol. 2013 Aug;94(Pt 8):1723-33. doi: 10.1099/vir.0.052613-0. Epub 2013 May 8. [PubMed:23658209]
  28. Xiong JP, Stehle T, Diefenbach B, Zhang R, Dunker R, Scott DL, Joachimiak A, Goodman SL, Arnaout MA: Crystal structure of the extracellular segment of integrin alpha Vbeta3. Science. 2001 Oct 12;294(5541):339-45. Epub 2001 Sep 6. [PubMed:11546839]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00098Antithymocyte immunoglobulin (rabbit)approvedyesDetails
DB00451LevothyroxineapprovedyesDetails