Calcitonin gene-related peptide 1

Details

Name
Calcitonin gene-related peptide 1
Synonyms
  • Alpha-type CGRP
  • CALC1
  • Calcitonin gene-related peptide I
  • CGRP-I
Gene Name
CALCA
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037124|Calcitonin gene-related peptide 1
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQ
MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG
RRRRDLQA
Number of residues
128
Molecular Weight
13897.755
Theoretical pI
9.4
GO Classification
Functions
protein complex binding / receptor binding
Processes
activation of adenylate cyclase activity / antibacterial humoral response / antifungal humoral response / cell-cell signaling / cytosolic calcium ion homeostasis / defense response to Gram-negative bacterium / defense response to Gram-positive bacterium / endothelial cell migration / endothelial cell proliferation / G-protein coupled receptor internalization / innate immune response / leukocyte cell-cell adhesion / negative regulation of blood pressure / negative regulation of bone resorption / negative regulation of calcium ion transport into cytosol / negative regulation of osteoclast differentiation / neurological system process involved in regulation of systemic arterial blood pressure / positive regulation of cAMP biosynthetic process / positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway / positive regulation of interleukin-1 alpha production / positive regulation of interleukin-8 production / positive regulation of macrophage differentiation / positive regulation of vasodilation / protein phosphorylation / receptor internalization / regulation of blood pressure / response to yeast / vasculature development
Components
cytoplasm / cytosol / extracellular region / extracellular space
General Function
Receptor binding
Specific Function
CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. It also elevates platelet cAMP.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0002194|387 bp
ATGGGCTTCCAAAAGTTCTCCCCCTTCCTGGCTCTCAGCATCTTGGTCCTGTTGCAGGCA
GGCAGCCTCCATGCAGCACCATTCAGGTCTGCCCTGGAGAGCAGCCCAGCAGACCCGGCC
ACGCTCAGTGAGGACGAAGCGCGCCTCCTGCTGGCTGCACTGGTGCAGGACTATGTGCAG
ATGAAGGCCAGTGAGCTGGAGCAGGAGCAAGAGAGAGAGGGCTCCAGAATCATTGCCCAG
AAGAGAGCCTGTGACACTGCCACCTGTGTGACTCATCGGCTGGCAGGCTTGCTGAGCAGA
TCAGGGGGTGTGGTGAAGAACAACTTTGTGCCCACCAATGTGGGTTCCAAAGCCTTTGGC
AGGCGCCGCAGGGACCTTCAAGCCTGA
Chromosome Location
Not Available
Locus
11p15.2-p15.1
External Identifiers
ResourceLink
UniProtKB IDP06881
UniProtKB Entry NameCALCA_HUMAN
GenBank Protein ID179828
GenBank Gene IDM12667
GenAtlas IDCALCA
HGNC IDHGNC:1437
General References
  1. Jonas V, Lin CR, Kawashima E, Semon D, Swanson LW, Mermod JJ, Evans RM, Rosenfeld MG: Alternative RNA processing events in human calcitonin/calcitonin gene-related peptide gene expression. Proc Natl Acad Sci U S A. 1985 Apr;82(7):1994-8. [Article]
  2. Broad PM, Symes AJ, Thakker RV, Craig RK: Structure and methylation of the human calcitonin/alpha-CGRP gene. Nucleic Acids Res. 1989 Sep 12;17(17):6999-7011. [Article]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
  4. Nelkin BD, Rosenfeld KI, de Bustros A, Leong SS, Roos BA, Baylin SB: Structure and expression of a gene encoding human calcitonin and calcitonin gene related peptide. Biochem Biophys Res Commun. 1984 Sep 17;123(2):648-55. [Article]
  5. Edbrooke MR, Parker D, McVey JH, Riley JH, Sorenson GD, Pettengill OS, Craig RK: Expression of the human calcitonin/CGRP gene in lung and thyroid carcinoma. EMBO J. 1985 Mar;4(3):715-24. [Article]
  6. Steenbergh PH, Hoppener JW, Zandberg J, Van de Ven WJ, Jansz HS, Lips CJ: Calcitonin gene related peptide coding sequence is conserved in the human genome and is expressed in medullary thyroid carcinoma. J Clin Endocrinol Metab. 1984 Aug;59(2):358-60. [Article]
  7. Craig RK, Riley JH, Edbrooke MR, Broad PM, Foord SM, Al-Kazwini SJ, Holman JJ, Marshall I: Expression and function of the human calcitonin/alpha-CGRP gene in health and disease. Biochem Soc Symp. 1986;52:91-105. [Article]
  8. Morris HR, Panico M, Etienne T, Tippins J, Girgis SI, MacIntyre I: Isolation and characterization of human calcitonin gene-related peptide. Nature. 1984 Apr 19-25;308(5961):746-8. [Article]
  9. Petermann JB, Born W, Chang JY, Fischer JA: Identification in the human central nervous system, pituitary, and thyroid of a novel calcitonin gene-related peptide, and partial amino acid sequence in the spinal cord. J Biol Chem. 1987 Jan 15;262(2):542-5. [Article]
  10. Kitamura K, Kangawa K, Kawamoto M, Ichiki Y, Matsuo H, Eto T: Isolation and characterization of peptides which act on rat platelets, from a pheochromocytoma. Biochem Biophys Res Commun. 1992 May 29;185(1):134-41. [Article]
  11. Breeze AL, Harvey TS, Bazzo R, Campbell ID: Solution structure of human calcitonin gene-related peptide by 1H NMR and distance geometry with restrained molecular dynamics. Biochemistry. 1991 Jan 15;30(2):575-82. [Article]
  12. Hubbard JA, Martin SR, Chaplin LC, Bose C, Kelly SM, Price NC: Solution structures of calcitonin-gene-related-peptide analogues of calcitonin-gene-related peptide and amylin. Biochem J. 1991 May 1;275 ( Pt 3):785-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04869OlcegepantinvestigationalunknownDetails
DB12228TelcagepantinvestigationalunknownDetails
DB14040Eptinezumabapproved, investigationalyesbinderantibodyDetails
DB14042Galcanezumabapproved, investigationalyesantibodyDetails
DB14041Fremanezumabapproved, investigationalyesbinderantibodyDetails